1CBV: Protein autoantibody-light chain)

An autoantibody to single-stranded DNA: comparison of the three-dimensional structures of the unliganded FAB and a deoxynucleotide-FAB complex. Determined by X-ray diffraction at 2.66 Å resolution. Released 31 Jan 1994.

Method: X-ray diffraction
Resolution: 2.66 Å
Organism: Mus musculus
Chains: 3
Atoms: 3,408
Mol. weight: 48.53 kDa
Released: 31 Jan 1994

Explore 1CBV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CBV contains 11 α-helices and 44 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 5 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	7
β-strand	11-12	2	8
β-strand	18-23	6	7
α-helix	29-31	3
β-strand	34-39	6	9
β-strand	45-51	7	9
β-strand	60-62	3	9
β-strand	70-75	6	7
α-helix	76-78	3
β-strand	80-85	6	7
α-helix	90-92	3
β-strand	94-102	9	9
β-strand	106-111	6	9
β-strand	116-117	2	9
β-strand	118-119	2	8
β-strand	128-132	5	10
β-strand	143-153	11	10
β-strand	159-164	6	11
α-helix	171	1
β-strand	172-173	2	10
α-helix	174-176	3
β-strand	177-179	3	10
β-strand	182-192	11	10
β-strand	201-207	7	11
β-strand	212-218	7	11

Chain L: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
β-strand	5-7	3	2
β-strand	10-13	4	3
β-strand	21-24	4	2
β-strand	38-43	6	3
β-strand	50-54	5	3
β-strand	58-59	2	3
β-strand	67-72	6	2
β-strand	75-80	6	2
α-helix	85-87	3
β-strand	90-95	6	3
α-helix	101	1
β-strand	102-103	2	3
β-strand	104	1	1
β-strand	107-111	5	3
β-strand	116	1	4
α-helix	117-118	2
β-strand	119-123	5	5
α-helix	124-126	3
α-helix	127-130	4
β-strand	134-144	11	5
β-strand	145	1	4
β-strand	150-155	6	6
β-strand	158	1	6
β-strand	164-165	2	5
β-strand	168	1	5
β-strand	178-187	10	5
α-helix	188-191	4
β-strand	196-202	7	6
β-strand	210-215	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(tptp*t)-3')	D	DNA	3
Protein (FAB (BV04-01) autoantibody-light chain)	L	protein	219	Mus musculus	A2NHM3 (AlphaFold model)
Protein (FAB (BV04-01) autoantibody-heavy chain)	H	protein	219	Mus musculus	P01867 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>1CBV_1 DNA (5'-D(*TP*TP*T)-3') (chains D)
TTT

Sequence of entity 2 (L), FASTA

>1CBV_2 PROTEIN (FAB (BV04-01) AUTOANTIBODY-LIGHT CHAIN) (chains L)
DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRF
SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPLTFGAGTKLELKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 3 (H), FASTA

>1CBV_3 PROTEIN (FAB (BV04-01) AUTOANTIBODY-HEAVY CHAIN) (chains H)
EVQPVETGGGLVQPKGSLKLSCAASGFSFNTNAMNWVRQAPGKGLEWVARIRSKSNNYAT
YYADSVKDRFTISRDDSQNMLYLQMNNLKTEDTAMYYCVRDQTGTAWFAYWGQGTLVTVS
AAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQS
GLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLE

Primary citation

An autoantibody to single-stranded DNA: comparison of the three-dimensional structures of the unliganded Fab and a deoxynucleotide-Fab complex. Herron, J.N., He, X.M., Ballard, D.W. et al. Proteins (1991) 11:159-175. DOI 10.1002/prot.340110302 · PubMed

Other PDB entries of the same protein (UniProt A2NHM3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PXR 1.56 Å, Anti-TAU BIIB092 FAB with TAU peptide
4TPR 1.6 Å, Structure of Tau5 antibody Fab fragment
4TQE 1.6 Å, Structure of tau peptide in complex with Tau5 antibody Fab fragment
3V4U 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
3UO1 1.64 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
2IPU 1.65 Å, PFA1 Fab fragment complexed with Abeta 1-8 peptide
3V52 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
2DQU 1.7 Å, Crystal form II: high resolution crystal structure of the complex of the hydrolytic…
3UYR 1.7 Å, Structure of a monoclonal antibody complexed with its MHC-I antigen
1ZEA 1.78 Å, Structure of the anti-cholera toxin antibody Fab fragment TE33 in complex with a D-peptide
1PZ5 1.8 Å, Structural basis of peptide-carbohydrate mimicry in an antibody combining site
2DQT 1.8 Å, High resolution crystal structure of the complex of the hydrolytic antibody Fab 6D9 and…

Browse structure collections

About this viewer

MolViewer shows 1CBV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.