1CI4: Human barrier-to-autointegration factor

The crystal structure of human barrier-to-autointegration factor (BAF). Determined by X-ray diffraction at 1.9 Å resolution. Released 16 Aug 2000.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,617
Mol. weight: 20.33 kDa
Released: 16 Aug 2000

Explore 1CI4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CI4 contains 12 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	5-11	7
α-helix	20-22	3
α-helix	28-36	9
α-helix	42-51	10
α-helix	56-67	12
α-helix	71-88	18

Chain B: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
β-strand	19	1	1
α-helix	20-22	3
α-helix	28-36	9
β-strand	41	1	1
α-helix	42-51	10
α-helix	56-67	12
α-helix	71-88	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (barrier-to-autointegration factor (baf))	A, B	protein	89	Homo sapiens	O75531 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1CI4_1 PROTEIN (BARRIER-TO-AUTOINTEGRATION FACTOR (BAF)) (chains A, B)
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFR
EWLKDTCGANAKQSRDCFGCLREWCDAFL

Primary citation

Structural basis of DNA bridging by barrier-to-autointegration factor. Umland, T.C., Wei, S.Q., Craigie, R. et al. Biochemistry (2000) 39:9130-9138. DOI 10.1021/bi000572w · PubMed

Other PDB entries of the same protein (UniProt O75531 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NDY 1.44 Å, Di-phosphorylated Barrier-to-Autointegration Factor (BAF) in complex with LEM domain of…
7Z21 1.63 Å, BAF A12T bound to the lamin A/C Ig-fold domain
6URE 1.65 Å, Barrier-to-autointegration factor Aqueous: 1 of 14 in MSCS set
6URJ 1.65 Å, Barrier-to-autointegration factor soaked in Acetone: 1 of 14 in MSCS set
6URZ 1.65 Å, Barrier-to-autointegration factor soaked in methanol: 1 of 14 in MSCS set
6US0 1.65 Å, Barrier-to-autointegration factor soaked in R,S,R-bisfuranol (RSR): 1 of 14 in MSCS set
6US1 1.65 Å, Barrier-to-autointegration factor soaked in isobutanol: 1 of 14 in MSCS set
6US7 1.65 Å, Barrier-to-autointegration factor soaked in TMAO: 1 of 14 in MSCS set
6USD 1.65 Å, Barrier-to-autointegration factor soaked in ethanol: 1 of 14 in MSCS set
6USI 1.65 Å, Barrier-to-autointegration factor soaked in 1,6-hexanediol: 1 of 14 in MSCS set
6URN 1.68 Å, Barrier-to-autointegration factor t-butanol: 1 of 14 in MSCS set
6USB 1.68 Å, Barrier-to-autointegration factor soaked in urea: 1 of 14 in MSCS set

Browse structure collections

About this viewer

MolViewer shows 1CI4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.