1CJG: Lac repressor HP62-DNA complex

NMR structure of lac repressor HP62-DNA complex. Determined by solution NMR. Released 1 Jan 2000.

Method: Solution NMR
Organism: Escherichia coli
Chains: 4
Atoms: 1,852
Mol. weight: 27.14 kDa
Released: 1 Jan 2000

Explore 1CJG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CJG contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	6-13	8
α-helix	17-24	8
α-helix	32-45	14
α-helix	51-56	6

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	6-13	8
α-helix	17-24	8
α-helix	32-41	10
α-helix	42-46	5
α-helix	51-56	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(gpapaptptpgptpgpapgpcpgpcptpcpapcpapaptptpc)-3')	C, D	DNA	22
Protein (lac repressor)	A, B	protein	62	Escherichia coli	P03023 (AlphaFold model)

Sequence of entity 1 (C, D), FASTA

>1CJG_1 DNA (5'-D(*GP*AP*AP*TP*TP*GP*TP*GP*AP*GP*CP*GP*CP*TP*CP*AP*CP*AP*AP*TP*TP*C)-3') (chains C, D)
GAATTGTGAGCGCTCACAATTC

Sequence of entity 2 (A, B), FASTA

>1CJG_2 PROTEIN (LAC REPRESSOR) (chains A, B)
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNRVAQQLAGKQ
SL

Primary citation

The solution structure of Lac repressor headpiece 62 complexed to a symmetrical lac operator. Spronk, C.A., Bonvin, A.M., Radha, P.K. et al. Structure (1999) 7:1483-1492. DOI 10.1016/S0969-2126(00)88339-2 · PubMed

Other PDB entries of the same protein (UniProt P03023 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8GOH 1.1 Å, Homotetramic Antiparallel Coiled-Coil of 23-residues LacI C-terminal tetramerization helix
1JYE 1.7 Å, Structure of a Dimeric Lac Repressor with C-terminal Deletion and K84L Substitution
2P9H 2.0 Å, High resolution structure of the Lactose Repressor bound to IPTG
3EDC 2.1 Å, Crystal Structure of a 1.6-hexanediol Bound Tetrameric Form of Escherichia coli…
1EFA 2.6 Å, Crystal structure of the lac repressor dimer bound to operator and the anti-inducer onpf
1TLF 2.6 Å, Unprecedented quaternary structure of E. Coli lac repressor core tetramer: implications…
1LBI 2.7 Å, Lac repressor
4RZS 2.71 Å, Lac repressor engineered to bind sucralose, unliganded tetramer
1JYF 3.0 Å, Structure of the Dimeric Lac Repressor with an 11-residue C-terminal Deletion.
4RZT 3.1 Å, Lac repressor engineered to bind sucralose, sucralose-bound tetramer
1LBH 3.2 Å, Intact lactose operon repressor with gratuitous inducer iptg
2PAF 3.5 Å, Crystal Structure of the Lactose Repressor bound to anti-inducer ONPF in induced state

Browse structure collections

About this viewer

MolViewer shows 1CJG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.