Molecular insights into PEBP2/CBF-smmhc associated acute leukemia revealed from the three-dimensional structure of PEBP2/CBF beta. Determined by solution NMR. Released 1 Jan 2000.
Explore 1CL3 in 3D Show helices and sheets RCSB PDB PDBe
1CL3 contains 5 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-14 | 8 | |
| α-helix | 17-21 | 5 | |
| β-strand | 24-26 | 3 | 1 |
| β-strand | 27-29 | 3 | 2 |
| α-helix | 38-49 | 12 | |
| β-strand | 52-57 | 6 | 2 |
| β-strand | 63-67 | 5 | 2 |
| α-helix | 83-89 | 7 | |
| β-strand | 94-96 | 3 | 1 |
| β-strand | 99-102 | 4 | 3 |
| β-strand | 107-110 | 4 | 3 |
| β-strand | 113-115 | 3 | 1 |
| β-strand | 122-124 | 3 | 1 |
| β-strand | 125-126 | 2 | 3 |
| α-helix | 130-138 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polyomavirus enhancer binding protein 2 | A | protein | 138 | Homo sapiens | Q13951 (AlphaFold model) |
>1CL3_1 POLYOMAVIRUS ENHANCER BINDING PROTEIN 2 (chains A) VVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQTRFQNACRDGRSEIAFVATGTN LSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLHRLDGMG CLEFDEERAQQEDALAQQ
Molecular insights into PEBP2/CBF beta-SMMHC associated acute leukemia revealed from the structure of PEBP2/CBF beta. Goger, M., Gupta, V., Kim, W.Y. et al. Nat Struct Biol (1999) 6:620-623. DOI 10.1038/10664 · PubMed
Other PDB entries of the same protein (UniProt Q13951 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1CL3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.