1CM9: Viral macrophage inflammatory protein-II

Crystal structure of viral macrophage inflammatory protein-II. Determined by X-ray diffraction at 2.1 Å resolution. Released 24 Jun 1999.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Human herpesvirus 8
Chains: 2
Atoms: 1,064
Mol. weight: 16.93 kDa
Released: 24 Jun 1999

Explore 1CM9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CM9 contains 12 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	12-14	3	1
α-helix	22-24	3
α-helix	25-27	3
β-strand	28-33	6	2
α-helix	34-35	2
β-strand	43-47	5	2
β-strand	52-55	4	2
α-helix	60-68	9
α-helix	70	1
β-strand	71	1	2
α-helix	72	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (viral macrophage inflammatory protein-II)	A, B	protein	74	Human herpesvirus 8	Q98157 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1CM9_1 PROTEIN (VIRAL MACROPHAGE INFLAMMATORY PROTEIN-II) (chains A, B)
GDTLGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKD
WVKKLMQQLPVTAR

Primary citation

Comparison of the structure of vMIP-II with eotaxin-1, RANTES, and MCP-3 suggests a unique mechanism for CCR3 activation. Fernandez, E.J., Wilken, J., Thompson, D.A. et al. Biochemistry (2000) 39:12837-12844. DOI 10.1021/bi001166f · PubMed

Other PDB entries of the same protein (UniProt Q98157 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FHT 1.7 Å, Crystal Structure of Viral Macrophage Inflammatory Protein-II
2FJ2 2.3 Å, Crystal Structure of Viral Macrophage Inflammatory Protein-II
4RWS 3.1 Å, Crystal structure of CXCR4 and viral chemokine antagonist vMIP-II complex (PSI Community…
1HFF NMR solution structures of the vMIP-II 1-10 peptide from Kaposi's sarcoma-associated…
1HFG NMR solution structure of vMIP-II 1-71 from Kaposi's sarcoma-associated herpesvirus…
1HFN NMR solution structures of vMIP-II 1-71 from Kaposi's sarcoma-associated herpesvirus.
1HHV Solution structure of virus chemokine vmip-II
1VMP Structure of the anti-HIV chemokine vmip-II

Browse structure collections

About this viewer

MolViewer shows 1CM9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.