2FHT: Viral Macrophage Inflammatory Protein-II

Crystal Structure of Viral Macrophage Inflammatory Protein-II. Determined by X-ray diffraction at 1.7 Å resolution. Released 26 Dec 2006.

Method: X-ray diffraction
Resolution: 1.7 Å
Chains: 1
Atoms: 558
Mol. weight: 8.14 kDa
Released: 26 Dec 2006

Explore 2FHT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FHT contains 5 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	19-21	3
α-helix	22-24	3
β-strand	25-30	6	1
α-helix	31-32	2
β-strand	39-44	6	1
β-strand	49-53	5	1
α-helix	57-65	9
α-helix	67	1
β-strand	68	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Viral macrophage inflammatory protein-II	A	protein	71		Q98157 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FHT_1 Viral macrophage inflammatory protein-II (chains A)
LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVK
KLMQQLPVTAR

Primary citation

Crystal structure of chemically synthesized vMIP-II. Li, Y., Liu, D., Cao, R. et al. Proteins (2007) 67:243-246. DOI 10.1002/prot.21172 · PubMed

Other PDB entries of the same protein (UniProt Q98157 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1CM9 2.1 Å, Crystal structure of viral macrophage inflammatory protein-II
2FJ2 2.3 Å, Crystal Structure of Viral Macrophage Inflammatory Protein-II
4RWS 3.1 Å, Crystal structure of CXCR4 and viral chemokine antagonist vMIP-II complex (PSI Community…
1HFF NMR solution structures of the vMIP-II 1-10 peptide from Kaposi's sarcoma-associated…
1HFG NMR solution structure of vMIP-II 1-71 from Kaposi's sarcoma-associated herpesvirus…
1HFN NMR solution structures of vMIP-II 1-71 from Kaposi's sarcoma-associated herpesvirus.
1HHV Solution structure of virus chemokine vmip-II
1VMP Structure of the anti-HIV chemokine vmip-II

Browse structure collections

About this viewer

MolViewer shows 2FHT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.