Immunoglobulin motif DNA-recognition and heterodimerization for the PEBP2/CBF runt-domain. Determined by solution NMR. Released 5 Jan 2000.
Explore 1CMO in 3D Show helices and sheets RCSB PDB PDBe
1CMO contains 5 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 54-57 | 4 | |
| β-strand | 63 | 1 | 1 |
| β-strand | 70-72 | 3 | 1 |
| β-strand | 78 | 1 | 2 |
| β-strand | 90-93 | 4 | 1 |
| β-strand | 103-106 | 4 | 3 |
| β-strand | 109 | 1 | 3 |
| α-helix | 113-115 | 3 | |
| β-strand | 116 | 1 | 4 |
| β-strand | 122 | 1 | 3 |
| α-helix | 123-124 | 2 | |
| β-strand | 128-130 | 3 | 1 |
| β-strand | 137 | 1 | 4 |
| α-helix | 145 | 1 | |
| β-strand | 146-152 | 7 | 3 |
| β-strand | 158-164 | 7 | 3 |
| β-strand | 167 | 1 | 2 |
| α-helix | 175-177 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polyomavirus enhancer binding protein 2 | A | protein | 127 | Homo sapiens | Q01196 (AlphaFold model) |
>1CMO_1 POLYOMAVIRUS ENHANCER BINDING PROTEIN 2 (chains A) VEVLADHPGELVRTDSPNFLCSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTVMAGNDE NYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVD GPREPRR
Immunoglobulin motif DNA recognition and heterodimerization of the PEBP2/CBF Runt domain. Nagata, T., Gupta, V., Sorce, D. et al. Nat Struct Biol (1999) 6:615-618. DOI 10.1038/10658 · PubMed
Other PDB entries of the same protein (UniProt Q01196 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1CMO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.