Low density lipoprotein receptor-related protein complement repeat 8. Determined by solution NMR. Released 23 Dec 1998.
Explore 1CR8 in 3D Show helices and sheets RCSB PDB PDBe
1CR8 contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-12 | 2 | 1 |
| β-strand | 19-20 | 2 | 1 |
| α-helix | 22-24 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (low density lipoprotein receptor related protein) | A | protein | 42 | Homo sapiens | Q07954 (AlphaFold model) |
>1CR8_1 PROTEIN (LOW DENSITY LIPOPROTEIN RECEPTOR RELATED PROTEIN) (chains A) PGGCHTDEFQCRLDGLCIPLRWRCDGDTDCMDSSDEKSCEGV
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
NMR solution structure of complement-like repeat CR8 from the low density lipoprotein receptor-related protein. Huang, W., Dolmer, K., Gettins, P.G. J Biol Chem (1999) 274:14130-14136. DOI 10.1074/jbc.274.20.14130 · PubMed
Other PDB entries of the same protein (UniProt Q07954 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1CR8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.