1CZ7: Microtubule motor protein ncd

The crystal structure of a minus-end directed microtubule motor protein ncd reveals variable dimer conformations. Determined by X-ray diffraction at 2.9 Å resolution. Released 5 Nov 1999.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Drosophila melanogaster
Chains: 4
Atoms: 11,439
Mol. weight: 186.27 kDa
Ligands: MG, ADP
Released: 5 Nov 1999

Explore 1CZ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CZ7 contains 59 α-helices and 66 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	322-346	25
β-strand	349	1	1
β-strand	352-355	4	1
α-helix	357-359	3
β-strand	368-371	4	2
β-strand	377-382	6	2
α-helix	387-389	3
β-strand	395-397	3	2
β-strand	401-402	2	1
α-helix	408-413	6
α-helix	416-423	8
β-strand	428-434	7	1
α-helix	440-444	5
β-strand	446	1	3
β-strand	451	1	3
α-helix	453-468	16
α-helix	469-471	3
β-strand	473-484	12	1
β-strand	489-491	3	1
β-strand	502-505	4	4
β-strand	508-514	7	4
β-strand	520	1	1
α-helix	525-537	13
α-helix	550-552	3
β-strand	554-565	12	1
β-strand	571-583	13	1
α-helix	600-614	15
α-helix	622-624	3
α-helix	626-631	6
α-helix	632-634	3
β-strand	640-647	8	1
α-helix	651-668	18

Chain B: 15 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	325-346	22
β-strand	349-355	7	5
α-helix	356-359	4
α-helix	360-362	3
β-strand	371	1	6
β-strand	377-379	3	6
α-helix	385-388	4
β-strand	395-397	3	6
β-strand	401-402	2	5
α-helix	408-423	16
β-strand	427-433	7	5
α-helix	440-444	5
β-strand	446	1	7
β-strand	451	1	7
α-helix	453-468	16
α-helix	469-471	3
β-strand	473-484	12	5
β-strand	489-491	3	5
β-strand	502-505	4	8
β-strand	508-514	7	8
β-strand	520	1	5
α-helix	525-537	13
α-helix	550-552	3
β-strand	554-565	12	5
β-strand	571-580	10	5
α-helix	601-614	14
α-helix	622-624	3
α-helix	626-630	5
α-helix	632-634	3
β-strand	640-647	8	5
α-helix	651-667	17

Chain C: 14 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	297-346	50
β-strand	349-355	7	9
α-helix	356-359	4
β-strand	367	1	10
β-strand	371	1	11
β-strand	377-379	3	11
α-helix	385-388	4
β-strand	395-397	3	11
β-strand	401-402	2	9
α-helix	408-423	16
β-strand	427-433	7	9
α-helix	440-444	5
β-strand	446	1	12
β-strand	451	1	12
α-helix	453-468	16
α-helix	469-471	3
β-strand	473-484	12	9
β-strand	489-491	3	9
β-strand	502-505	4	13
β-strand	508-514	7	13
α-helix	525-537	13
α-helix	550-552	3
β-strand	554-565	12	9
β-strand	569-580	12	9
α-helix	600-614	15
α-helix	622-624	3
α-helix	626-631	6
α-helix	632-634	3
β-strand	641-647	7	9
β-strand	650	1	10
α-helix	651-665	15

Chain D: 15 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	298-346	49
β-strand	349-355	7	14
α-helix	357-359	3
α-helix	360-362	3
β-strand	369-371	3	15
β-strand	377-381	5	15
α-helix	385-388	4
β-strand	395-397	3	15
β-strand	401-402	2	14
α-helix	408-423	16
β-strand	428-433	6	14
α-helix	440-444	5
β-strand	446	1	16
β-strand	451	1	16
α-helix	453-468	16
α-helix	469-471	3
β-strand	474-484	11	14
β-strand	489-491	3	14
β-strand	501-505	5	17
β-strand	508-515	8	17
β-strand	520	1	14
α-helix	525-537	13
α-helix	550-552	3
β-strand	554-565	12	14
β-strand	569-580	12	14
α-helix	601-614	14
α-helix	622-624	3
α-helix	626-631	6
α-helix	632-634	3
β-strand	640-647	8	14
α-helix	651-668	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule motor protein ncd	A, B, C, D	protein	406	Drosophila melanogaster	P20480 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1CZ7_1 MICROTUBULE MOTOR PROTEIN NCD (chains A, B, C, D)
ALSTEVVHLRQRTEELLRCNEQQAAELETCKEQLFQSNMERKELHNTVMDLRGNIRVFCR
IRPPLESEENRMCCTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDIFEM
VSPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPESVGVIPRTVDLLFDSIRGYRNLGWE
YEIKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEETVLDPNHLRHLMHT
AKMNRATASTAGNERSSRSHAVTKLELIGRHAEKQEISVGSINLVDLAGSESPKTSTRMT
ETKNINRSLSELTNVILALLQKQDHIPYRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCF
QESVKSLRFAASVNSCKMTKAKRNRYLNNSVANSSTQSNNSGSFDK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	4

Primary citation

The crystal structure of the minus-end-directed microtubule motor protein ncd reveals variable dimer conformations. Kozielski, F., De Bonis, S., Burmeister, W.P. et al. Structure (1999) 7:1407-1416. DOI 10.1016/S0969-2126(00)80030-1 · PubMed

Other PDB entries of the same protein (UniProt P20480 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3U06 2.35 Å, Crystal structure of the kinesin-14 NcdG347D
1N6M 2.5 Å, Rotation of the stalk/neck and one head in a new crystal structure of the kinesin motor…
2NCD 2.5 Å, Ncd (non-claret disjunctional) dimer from D. Melanogaster
3L1C 2.75 Å, Kinesin-14 Protein Ncd, T436S Mutant
5W3D 2.79 Å, The structure of kinesin-14 wild-type Ncd-ADP dimer
5HLE 2.9 Å, Structural basis of backwards motion in kinesin-14: minus-end directed nKn664 in the ADP…
8YUE 3.15 Å, Crystal structure of the kinesin-14 motor protein from Drosophila melanogaster
8YY3 3.24 Å, Kinesin-14 in nucleotide-free state bound to 14 PF Microtubule
8YY2 3.6 Å, Kinesin-14 in nucleotide-free state bound to 13 PF Microtubule
8YY5 3.99 Å, Kinesin-14 with AlF3 bound to 14 PF Microtubule
8YY4 4.02 Å, Kinesin-14 with AlF3 bound to 13 PF Microtubule
5HNZ 5.8 Å, Structural basis of backwards motion in kinesin-14: plus-end directed nKn669 in the…

Browse structure collections

About this viewer

MolViewer shows 1CZ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.