Dictyostelium myosin S1DC (motor domain fragment) complexed with M-nitrophenyl aminoethyldiphosphate beryllium trifluoride. Determined by X-ray diffraction at 2.0 Å resolution. Released 12 Jan 2000.
Explore 1D0X in 3D Show helices and sheets RCSB PDB PDBe
1D0X contains 37 α-helices and 27 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-15 | 6 | |
| α-helix | 25-28 | 4 | |
| β-strand | 34-37 | 4 | 1 |
| β-strand | 48-55 | 8 | 1 |
| β-strand | 59-63 | 5 | 1 |
| β-strand | 69-73 | 5 | 1 |
| α-helix | 74-76 | 3 | |
| β-strand | 78-79 | 2 | 1 |
| α-helix | 80-82 | 3 | |
| α-helix | 83-85 | 3 | |
| β-strand | 90 | 1 | 2 |
| α-helix | 91-93 | 3 | |
| α-helix | 99-111 | 13 | |
| β-strand | 116-119 | 4 | 2 |
| β-strand | 122-126 | 5 | 2 |
| α-helix | 137-143 | 7 | |
| α-helix | 148-150 | 3 | |
| α-helix | 155-169 | 15 | |
| β-strand | 173-178 | 6 | 2 |
| α-helix | 185-200 | 16 | |
| α-helix | 210-226 | 17 | |
| β-strand | 227-228 | 2 | 3 |
| β-strand | 236-237 | 2 | 3 |
| β-strand | 240-247 | 8 | 2 |
| β-strand | 253-261 | 9 | 2 |
| α-helix | 265-268 | 4 | |
| β-strand | 278 | 1 | 3 |
| α-helix | 279-287 | 9 | |
| α-helix | 290-296 | 7 | |
| α-helix | 301-303 | 3 | |
| α-helix | 320-334 | 15 | |
| α-helix | 338-355 | 18 | |
| β-strand | 360 | 1 | 4 |
| β-strand | 368 | 1 | 4 |
| α-helix | 373-382 | 10 | |
| α-helix | 386-394 | 9 | |
| β-strand | 397-400 | 4 | 5 |
| β-strand | 403-406 | 4 | 5 |
| α-helix | 411-441 | 31 | |
| β-strand | 448-454 | 7 | 2 |
| β-strand | 464 | 1 | 6 |
| α-helix | 466-497 | 32 | |
| α-helix | 510-518 | 9 | |
| α-helix | 525-533 | 9 | |
| α-helix | 540-551 | 12 | |
| β-strand | 558-559 | 2 | 6 |
| β-strand | 567-572 | 6 | 6 |
| β-strand | 575-580 | 6 | 6 |
| α-helix | 584-589 | 6 | |
| α-helix | 594-601 | 8 | |
| α-helix | 608-613 | 6 | |
| α-helix | 615-618 | 4 | |
| α-helix | 630-646 | 17 | |
| β-strand | 649-656 | 8 | 2 |
| α-helix | 669-678 | 10 | |
| α-helix | 681-689 | 9 | |
| β-strand | 694-697 | 4 | 7 |
| α-helix | 698-705 | 8 | |
| α-helix | 706-708 | 3 | |
| α-helix | 719-729 | 11 | |
| α-helix | 734-736 | 3 | |
| β-strand | 737-739 | 3 | 7 |
| β-strand | 743-746 | 4 | 7 |
| α-helix | 750-755 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Myosin S1DC motor domain | A | protein | 761 | Dictyostelium discoideum | P08799 (AlphaFold model) |
>1D0X_1 MYOSIN S1DC MOTOR DOMAIN (chains A) MNPIHDRTSDYHKYLKVKQGDSDLFKLTVSDKRYIWYNPDPKERDSYECGEIVSETSDSF TFKTVDGQDRQVKKDDANQRNPIKFDGVEDMSELSYLNEPAVFHNLRVRYNQDLIYTYSG LFLVAVNPFKRIPIYTQEMVDIFKGRRRNEVAPHIFAISDVAYRSMLDDRQNQSLLITGE SGAGKTENTKKVIQYLASVAGRNQANGSGVLEQQILQANPILEAFGNAKTTRNNNSSRFG KFIEIQFNNAGFISGASIQSYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKKALHLAG PESFNYLNQSGCVDIKGVSDSEEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFE KGAGEGAVLKDKTALNAASTVFGVNPSVLEKALMEPRILAGRDLVAQHLNVEKSSSSRDA LVKALYGRLFLWLVKKINNVLCQERKAYFIGVLDISGFEIFKVNSFEQLCINYTNEKLQQ FFNHHMFKLEQEEYLKEKINWTFIDFGLDSQATIDLIDGRQPPGILALLDEQSVFPNATD NTLITKLHSHFSKKNAKYEEPRFSKTEFGVTHYAGQVMYEIQDWLEKNKDPLQQDLELCF KDSSDNVVTKLFNDPNIASRAKKGANFITVAAQYKEQLASLMATLETTNPHFVRCIIPNN KQLPAKLEDKVVLDQLRCNGVLEGIRITRKGFPNRIIYADFVKRYYLLAPNVPRDAEDSQ KATDAVLKHLNIDPEQYRFGITKIFFRAGQLARIEEAREPN
| ID | Name | Formula | Copies |
|---|---|---|---|
| MNQ | M-nitrophenyl aminoethyldiphosphate beryllium trifluoride | C8 H11 Be F3 N2 O9 P2 | 1 |
| MG | Magnesium ion | Mg | 1 |
X-ray structures of the Dictyostelium discoideum myosin motor domain with six non-nucleotide analogs. Gulick, A.M., Bauer, C.B., Thoden, J.B. et al. J Biol Chem (2000) 275:398-408. DOI 10.1074/jbc.275.1.398 · PubMed
Other PDB entries of the same protein (UniProt P08799 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1D0X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.