1D2Q: Human trail

Name: PDB 1D2Q: Crystal structure of human trail
Published: 2000-02-11
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: cytokine

Crystal structure of human trail. Determined by X-ray diffraction at 2.8 Å resolution. Released 11 Feb 2000.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,166
Mol. weight: 39.04 kDa
Released: 11 Feb 2000

Explore 1D2Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1D2Q contains 4 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	123-128	6	1
α-helix	129	1
β-strand	149-150	2	2
β-strand	154-155	2	1
β-strand	163-165	3	1
β-strand	167-170	4	2
β-strand	173-176	4	2
β-strand	180-190	11	1
β-strand	206-213	8	2
α-helix	219	1
β-strand	220-227	8	2
β-strand	240-250	11	1
β-strand	255-260	6	2
β-strand	266-267	2	1
β-strand	274-280	7	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tnf-related apoptosis inducing ligand	A, B	protein	168	Homo sapiens	P50591 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1D2Q_1 TNF-RELATED APOPTOSIS INDUCING LIGAND (chains A, B)
VRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLRNGE
LVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSK
DAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG

Primary citation

2.8 A resolution crystal structure of human TRAIL, a cytokine with selective antitumor activity. Cha, S.S., Kim, M.S., Choi, Y.H. et al. Immunity (1999) 11:253-261. DOI 10.1016/S1074-7613(00)80100-4 · PubMed

Other PDB entries of the same protein (UniProt P50591 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DG6 1.3 Å, Crystal structure of APO2L/TRAIL
1D4V 2.2 Å, Crystal structure of trail-DR5 complex
1DU3 2.2 Å, Crystal structure of TRAIL-SDR5
1D0G 2.4 Å, Crystal structure of death receptor 5 (DR5) bound to APO2L/TRAIL
5CIR 3.0 Å, Crystal structure of death receptor 4 (DR4; TNFFRSF10A) bound to TRAIL (TNFSF10)
4N90 3.3 Å, Crystal structure of ternary complex of TRAIL, DR5, and Fab fragment from a DR5 agonist…

Browse structure collections

About this viewer

MolViewer shows 1D2Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.