1D6G: Cholecystokinin type a receptor

Molecular complex of cholecystokinin-8 and N-terminus of the cholecystokinin a receptor by NMR spectroscopy. Determined by solution NMR. Released 17 Nov 1999.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 439
Mol. weight: 6.29 kDa
Released: 17 Nov 1999

Explore 1D6G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1D6G contains 2 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	16-17	2
β-strand	18	1	1
β-strand	28	1	1
α-helix	39-44	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cholecystokinin type a receptor	A	protein	47	Homo sapiens	P32238 (AlphaFold model)
cholecystokinin-8	B	protein	9	Homo sapiens

Sequence of entity 1 (A), FASTA

>1D6G_1 cholecystokinin type a receptor (chains A)
MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAQVILL

Sequence of entity 2 (B), FASTA

>1D6G_2 cholecystokinin-8 (chains B)
DYMGWMDFX

Primary citation

Molecular complex of cholecystokinin-8 and N-terminus of the cholecystokinin A receptor by NMR spectroscopy. Pellegrini, M., Mierke, D.F. Biochemistry (1999) 38:14775-14783. DOI 10.1021/bi991272l · PubMed

Other PDB entries of the same protein (UniProt P32238 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7MBX 1.95 Å, Human Cholecystokinin 1 receptor (CCK1R) Gs complex
7MBY 2.44 Å, Human Cholecystokinin 1 receptor (CCK1R) Gq chimera (mGsqi) complex
7F8Y 2.5 Å, Crystal structure of the cholecystokinin receptor CCKAR in complex with devazepide
9BKK 2.51 Å, Cholecystokinin 1 receptor (CCK1R) sterol 7M mutant, Gq chimera (mGsqi) complex
9BKJ 2.59 Å, Cholecystokinin 1 receptor (CCK1R) Y140A mutant, Gq chimera (mGsqi) complex
7F8U 2.8 Å, Crystal structure of the cholecystokinin receptor CCKAR in complex with lintitript
7EZM 2.9 Å, Cryo-EM structure of an activated Cholecystokinin A receptor (CCKAR)-Gq complex
7F8X 3.0 Å, Crystal structure of the cholecystokinin receptor CCKAR in complex with NN9056
7XOV 3.0 Å, Structural insights into human brain gut peptide cholecystokinin receptors
7EZK 3.1 Å, Cryo-EM structure of an activated Cholecystokinin A receptor (CCKAR)-Gs complex
7EZH 3.2 Å, Cryo-EM structure of an activated Cholecystokinin A receptor (CCKAR)-Gi complex
7XOU 3.2 Å, Structural insights into human brain gut peptide cholecystokinin receptors

Browse structure collections

About this viewer

MolViewer shows 1D6G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.