7F8X: Cholecystokinin receptor CCKAR

Crystal structure of the cholecystokinin receptor CCKAR in complex with NN9056. Determined by X-ray diffraction at 3.0 Å resolution. Released 29 Dec 2021.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Homo sapiens, Escherichia virus T4, synthetic construct
Chains: 2
Atoms: 3,597
Mol. weight: 61.58 kDa
Released: 29 Dec 2021

Explore 7F8X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7F8X contains 23 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	39-68	30
α-helix	75-92	18
α-helix	96-104	9
α-helix	111-143	33
α-helix	155-172	18
α-helix	175-178	4
β-strand	180-186	7	1
β-strand	192-198	7	1
α-helix	203-214	12
α-helix	215-219	5
α-helix	220-237	18
α-helix	242-250	9
β-strand	253-258	6	2
β-strand	264-267	4	2
β-strand	270-273	4	2
α-helix	278-423	11
α-helix	434-454	21
α-helix	458-462	5
α-helix	467-480	14
α-helix	482-486	5
α-helix	489-496	8
α-helix	500-507	8
α-helix	511-515	5
α-helix	517-529	13
α-helix	538-572	35
α-helix	574-580	7
α-helix	585-605	21
α-helix	610-612	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cholecystokinin receptor type A,Endolysin	A	protein	534	Homo sapiens, Escherichia virus T4	P00720, P32238 (AlphaFold model)
Asp-smf-nle-gly-trp-nle-oem-mea-NH2 (NN9056)	C	protein	9	synthetic construct

Sequence of entity 1 (A), FASTA

>7F8X_1 Cholecystokinin receptor type A,Endolysin (chains A)
DYKDDDDGAPDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLI
FLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGS
AVCKTTTYFMGTSVSVSTWNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFT
IMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGL
ISLELYQGINIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGR
NTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVA
GFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYAANLMAKKRVI
RMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCF
MNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGEFLEVLFQGPHHHHHHHHHH

Sequence of entity 2 (C), FASTA

>7F8X_2 ASP-SMF-NLE-GLY-TRP-NLE-OEM-MEA-NH2 (NN9056) (chains C)
DFLGWLXFX

Primary citation

Structures of the human cholecystokinin receptors bound to agonists and antagonists. Zhang, X., He, C., Wang, M. et al. Nat Chem Biol (2021) 17:1230-1237. DOI 10.1038/s41589-021-00866-8 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse structure collections

About this viewer

MolViewer shows 7F8X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.