1DAR: Elongation factor G

Elongation factor G in complex with GDP. Determined by X-ray diffraction at 2.4 Å resolution. Released 11 Jul 1996.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Thermus thermophilus
Chains: 1
Atoms: 4,893
Mol. weight: 77.42 kDa
Ligands: GDP
Released: 11 Jul 1996

Explore 1DAR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1DAR contains 23 α-helices and 43 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 43 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	12-19	8	1
α-helix	25-36	12
β-strand	69-74	6	1
β-strand	77-82	6	1
α-helix	83-85	3
α-helix	91-100	10
β-strand	103-109	7	1
α-helix	116-127	12
β-strand	132-137	6	1
α-helix	146-152	7
α-helix	153-157	5
β-strand	161-163	3	1
β-strand	165-168	4	2
α-helix	171-173	3
β-strand	176-179	4	2
β-strand	184-188	5	2
β-strand	196-199	4	2
α-helix	200-202	3
α-helix	203-205	3
α-helix	206-220	15
α-helix	225-233	9
α-helix	235-238	4
α-helix	239-251	13
β-strand	256-260	5	1
β-strand	262	1	3
α-helix	263-265	3
β-strand	267	1	3
α-helix	269-279	11
α-helix	281-282	2
β-strand	289-292	4	4
β-strand	298-301	4	4
β-strand	310-319	10	5
β-strand	323-332	10	5
β-strand	334-336	3	6
β-strand	340-343	4	5
β-strand	348-351	4	5
β-strand	354-358	5	5
β-strand	363-366	4	5
β-strand	368-370	3	6
β-strand	374-378	5	5
β-strand	388-391	4	5
β-strand	398	1	4
β-strand	439-441	3	7
β-strand	449-453	5	7
β-strand	470-472	3	7
β-strand	473	1	8
β-strand	477	1	8
β-strand	481	1	7
β-strand	484-486	3	9
β-strand	491-499	9	10
β-strand	506-516	11	10
β-strand	523-527	5	10
α-helix	539-549	11
β-strand	560	1	9
β-strand	563-570	8	10
β-strand	577	1	10
α-helix	579-595	17
β-strand	600-612	13	9
α-helix	619-626	8
β-strand	631-637	7	9
β-strand	640-648	9	9
α-helix	655-662	8
β-strand	668-678	11	9
α-helix	679-680	2
α-helix	681-688	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Elongation factor G	A	protein	691	Thermus thermophilus	Q5SHN5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1DAR_1 ELONGATION FACTOR G (chains A)
MAVKVEYDLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIGEVHEGAATMDFMEQERE
RGITITAAVTTCFWKDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSET
VWRQAEKYKVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDV
LRMKAYTYGNDLGTDIREIPIPEEYLDQAREYHEKLVEVAADFDENIMLKYLEGEEPTEE
ELVAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIKGTTPEGEVVE
IHPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHA
NHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVILESIEVPEPVIDVAIEPKTKAD
QEKLSQALARLAEEDPTFRVSTHPETGQTIISGMGELHLEIIVDRLKREFKVDANVGKPQ
VAYRETITKPVDVEGKFIRQTGGRGQYGHVKIKVEPLPRGSGFEFVNAIVGGVIPKEYIP
AVQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMAFKIAGSMAIKEAVQKGDPV
ILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLR
SKTQGRGSFVMFFDHYQEVPKQVQEKLIKGQ

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1

Primary citation

The structure of elongation factor G in complex with GDP: conformational flexibility and nucleotide exchange. al-Karadaghi, S., Aevarsson, A., Garber, M. et al. Structure (1996) 4:555-565. DOI 10.1016/S0969-2126(96)00061-5 · PubMed

Other PDB entries of the same protein (UniProt Q5SHN5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2EFG 2.6 Å, Translational elongation factor G complexed with GDP
1EFG 2.7 Å, The crystal structure of elongation factor G complexed with GDP, at 2.7 Å resolution
1ELO 2.8 Å, Elongation factor G without nucleotide
4WPO 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4WQF 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4WQU 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4WQY 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4V9H 2.86 Å, Crystal structure of the ribosome bound to elongation factor G in the guanosine…
4V90 2.95 Å, Thermus thermophilus Ribosome
5HAU 3.0 Å, Crystal structure of antimicrobial peptide Bac7(1-19) bound to the Thermus thermophilus…
4V9K 3.5 Å, 70S ribosome translocation intermediate GDPNP-I containing elongation factor EFG/GDPNP,…
4V9L 3.5 Å, 70S Ribosome translocation intermediate FA-3.6A containing elongation factor EFG/FUSIDIC…

Browse structure collections

About this viewer

MolViewer shows 1DAR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.