2EFG: Translational elongation factor G

Translational elongation factor G complexed with GDP. Determined by X-ray diffraction at 2.6 Å resolution. Released 30 Sept 1999.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Thermus thermophilus
Chains: 2
Atoms: 4,856
Mol. weight: 84.91 kDa
Ligands: GDP
Released: 30 Sept 1999

Explore 2EFG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2EFG contains 28 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 40 β-strands

Element	Residues	Length	Sheet
β-strand	12-19	8	1
α-helix	25-37	13
β-strand	69-74	6	1
β-strand	77-82	6	1
α-helix	91-100	10
β-strand	103-109	7	1
β-strand	113	1	1
α-helix	116-127	12
β-strand	132-137	6	1
α-helix	146-152	7
α-helix	153-157	5
β-strand	161-163	3	1
β-strand	165-168	4	2
α-helix	171-173	3
β-strand	176-179	4	2
β-strand	184-188	5	2
β-strand	196-199	4	2
α-helix	200-202	3
α-helix	203-205	3
α-helix	206-221	16
α-helix	225-232	8
α-helix	236-238	3
α-helix	239-251	13
β-strand	256-260	5	1
β-strand	262	1	3
β-strand	267	1	3
α-helix	269-278	10
α-helix	287-288	2
β-strand	289-291	3	4
β-strand	292	1	5
β-strand	299-301	3	4
β-strand	310-317	8	1
β-strand	325-332	8	1
β-strand	335-336	2	6
β-strand	339-342	4	1
β-strand	349-352	4	1
β-strand	354-359	6	1
β-strand	362-366	5	1
β-strand	368-369	2	6
β-strand	374-378	5	1
β-strand	388-391	4	1
β-strand	398	1	5
β-strand	484-486	3	7
β-strand	491-498	8	8
β-strand	507-516	10	8
β-strand	523-527	5	8
α-helix	536-538	3
α-helix	539-549	11
β-strand	560	1	7
β-strand	563-571	9	8
α-helix	579-595	17
β-strand	600-613	14	7
α-helix	617-623	7
α-helix	624-627	4
β-strand	631-633	3	9
β-strand	640-643	4	7
β-strand	644-645	2	9
β-strand	646-648	3	7
α-helix	649-652	4
α-helix	656-659	4
α-helix	660-662	3
β-strand	668-678	11	7
α-helix	679-680	2
α-helix	681-687	7

Chain B: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	706-710	5
α-helix	711-713	3
β-strand	723	1	10
β-strand	730	1	10
α-helix	763-766	4
α-helix	767-770	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (elongation factor G)	A	protein	691	Thermus thermophilus	Q5SHN5 (AlphaFold model)
Protein (elongation factor G domain 3)	B	protein	88	Thermus thermophilus

Sequence of entity 1 (A), FASTA

>2EFG_1 PROTEIN (ELONGATION FACTOR G) (chains A)
MAVKVEYDLKRLRNIGIAAHIDAGKTTTTERILYYTGRIHKIGEVHEGAATMDFMEQERE
RGITITAAVTTCFWKDHRINIIDTPGHVDFTIEVERSMRVLDGAIVVFDSSQGVEPQSET
VWRQAEKYKVPRIAFANKMDKTGADLWLVIRTMQERLGARPVVMQLPIGREDTFSGIIDV
LRMKAYTYGNDLGTDIREIPIPEEYLDNAREYHEKLVEVAADFDENIMLKYLEGEEPTEE
ELVAAIRKGTIDLKITPVFLGSALKNKGVQLLLDAVVDYLPSPLDIPPIKGTTPEGEVVE
IHPDPNGPLAALAFKIMADPYVGRLTFIRVYSGTLTSGSYVYNTTKGRKERVARLLRMHA
NHREEVEELKAGDLGAVVGLKETITGDTLVGEDAPRVILESIEVPEPVIDVAIEPKTKAD
QEKLSQALARLAEEDPTFRVSTHPETGQTIISGMGELHLEIIVDRLKREFKVDANVGKPQ
VAYRETITKPVDVEGKFIRQTGGRGQYGHVKIKVEPLPRGSGFEFVNAIVGGVIPKEYIP
AVQKGIEEAMQSGPLIGFPVVDIKVTLYDGSYHEVDSSEMAFKIAGSMAIKEAVQKGDPV
ILEPIMRVEVTTPEEYMGDVIGDLNARRGQILGMEPRGNAQVIRAFVPLAEMFGYATDLR
SKTQGRGSFVMFFDHYQEVPKQVQEKLIKGQ

Sequence of entity 2 (B), FASTA

>2EFG_2 PROTEIN (ELONGATION FACTOR G DOMAIN 3) (chains B)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXX

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1

Primary citation

The crystal structure of elongation factor G complexed with GDP, at 2.7 A resolution. Czworkowski, J., Wang, J., Steitz, T.A. et al. EMBO J (1994) 13:3661-3668. PubMed

Other PDB entries of the same protein (UniProt Q5SHN5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1DAR 2.4 Å, Elongation factor G in complex with GDP
1EFG 2.7 Å, The crystal structure of elongation factor G complexed with GDP, at 2.7 Å resolution
1ELO 2.8 Å, Elongation factor G without nucleotide
4WPO 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4WQF 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4WQU 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4WQY 2.8 Å, Crystal structure of the Thermus thermophilus 70S ribosome in complex with elongation…
4V9H 2.86 Å, Crystal structure of the ribosome bound to elongation factor G in the guanosine…
4V90 2.95 Å, Thermus thermophilus Ribosome
5HAU 3.0 Å, Crystal structure of antimicrobial peptide Bac7(1-19) bound to the Thermus thermophilus…
4V9K 3.5 Å, 70S ribosome translocation intermediate GDPNP-I containing elongation factor EFG/GDPNP,…
4V9L 3.5 Å, 70S Ribosome translocation intermediate FA-3.6A containing elongation factor EFG/FUSIDIC…

Browse more

2EFG is part of these collections:

The ribosome and protein synthesis

About this viewer

MolViewer shows 2EFG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.