1DNK: DNase I-D(GGTATACC)2 complex

The X-ray structure of the DNase I-D(GGTATACC)2 complex at 2.3 Å resolution. Determined by X-ray diffraction at 2.3 Å resolution. Released 31 Jan 1994.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Bos taurus
Chains: 3
Atoms: 2,390
Mol. weight: 34.08 kDa
Released: 31 Jan 1994

Explore 1DNK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1DNK contains 13 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	2-11	10	1
α-helix	13-17	5
α-helix	19-29	11
β-strand	34-40	7	1
α-helix	46-55	10
β-strand	64-67	4	1
α-helix	68-70	3
β-strand	71	1	2
β-strand	78	1	2
β-strand	79-84	6	1
β-strand	89-96	8	3
α-helix	112-113	2
β-strand	114-120	7	3
β-strand	127-132	6	3
α-helix	137-139	3
α-helix	140-158	19
β-strand	163-168	6	3
α-helix	173-175	3
α-helix	180-183	4
α-helix	185-188	4
β-strand	193-194	2	3
β-strand	203	1	4
β-strand	212-217	6	3
α-helix	219-222	4
β-strand	225	1	5
β-strand	231-232	2	1
α-helix	235-239	5
α-helix	243-249	7
β-strand	252	1	4
β-strand	255-258	4	1
β-strand	259	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA (5'-d(gpgptpaptpap*c)-3')	B	DNA	7
DNA (5'-d(gpgptpaptpapcpc)-3')	C	DNA	8
Protein (deoxyribonuclease I (DNase I) (E.C.3.1.21.1))	A	protein	260	Bos taurus	P00639 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>1DNK_1 DNA (5'-D(*GP*GP*TP*AP*TP*AP*C)-3') (chains B)
GGTATAC

Sequence of entity 2 (C), FASTA

>1DNK_2 DNA (5'-D(*GP*GP*TP*AP*TP*AP*CP*C)-3') (chains C)
GGTATACC

Sequence of entity 3 (A), FASTA

>1DNK_3 PROTEIN (DEOXYRIBONUCLEASE I (DNASE I) (E.C.3.1.21.1)) (chains A)
LKIAAFNIRTFGETKMSNATLASYIVRIVRRYDIVLIQEVRDSHLVAVGKLLDYLNQDDP
NTYHYVVSEPLGRNSYKERYLFLFRPNKVSVLDTYQYDDGCESCGNDSFSREPAVVKFSS
HSTKVKEFAIVALHSAPSDAVAEINSLYDVYLDVQQKWHLNDVMLMGDFNADCSYVTSSQ
WSSIRLRTSSTFQWLIPDSADTTATSTNCAYDRIVVAGSLLQSSVVPGSAAPFDFQAAYG
LSNEMALAISDHYPVEVTLT

Primary citation

X-ray structure of the DNase I-d(GGTATACC)2 complex at 2.3 A resolution. Weston, S.A., Lahm, A., Suck, D. J Mol Biol (1992) 226:1237-1256. DOI 10.1016/0022-2836(92)91064-V · PubMed

Other PDB entries of the same protein (UniProt P00639 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2A40 1.8 Å, Ternary complex of the WH2 domain of WAVE with Actin-DNAse I
3W3D 1.8 Å, Crystal structure of smooth muscle G actin DNase I complex
2A42 1.85 Å, Actin-DNAse I Complex
2DNJ 2.0 Å, DNase I-induced DNA conformation. 2 Å structure of a DNase I-octamer complex
3DNI 2.0 Å, Crystallographic refinement and structure of DNase I at 2 Å resolution
2A3Z 2.08 Å, Ternary complex of the WH2 domain of WASP with Actin-DNAse I
2D1K 2.5 Å, Ternary complex of the WH2 domain of mim with actin-dnase I
7NXV 2.55 Å, Crystal structure of the complex of DNase I/G-actin/PPP1R15A_582-621
2A41 2.6 Å, Ternary complex of the WH2 Domain of WIP with Actin-DNAse I
1ATN 2.8 Å, Atomic structure of the actin:DNASE I complex
9NB9 3.03 Å, Viral protein DP71L in complex with phosphorylated eIF2alpha (NTD) and protein…
9FJY 3.79 Å, Structure of the DNase I- and phalloidin-bound pointed end of F-actin (conformer 2).

Browse structure collections

About this viewer

MolViewer shows 1DNK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.