1ATN: Atomic structure of the actin:DNASE I complex

Atomic structure of the actin:DNASE I complex. Determined by X-ray diffraction at 2.8 Å resolution. Released 15 Jul 1992.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Oryctolagus cuniculus, Bos taurus
Chains: 2
Atoms: 5,019
Mol. weight: 71.82 kDa
Ligands: CA, ATP
Released: 15 Jul 1992

Explore 1ATN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ATN contains 37 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
β-strand	16-21	6	1
β-strand	22	1	2
β-strand	24	1	2
β-strand	29-32	4	1
β-strand	35-38	4	3
β-strand	42-44	3	4
α-helix	47-49	3
β-strand	53-54	2	3
α-helix	56-60	5
α-helix	62-64	3
β-strand	65-68	4	3
β-strand	71-72	2	5
β-strand	75-76	2	5
α-helix	79-88	10
α-helix	89-94	6
α-helix	98-100	3
β-strand	103-107	5	1
α-helix	113-122	10
α-helix	123-127	5
β-strand	131-136	6	1
α-helix	137-144	8
β-strand	150-155	6	6
β-strand	160-166	7	6
β-strand	169-170	2	6
α-helix	172-174	3
β-strand	176-178	3	6
α-helix	182-194	13
α-helix	203-216	14
α-helix	224-232	9
β-strand	238-241	4	7
β-strand	247-250	4	7
α-helix	253-256	4
α-helix	259-262	4
α-helix	264-267	4
α-helix	274-282	9
α-helix	290-294	5
β-strand	297-300	4	6
α-helix	302-305	4
α-helix	309-318	10
α-helix	326-327	2
β-strand	329-330	2	6
α-helix	335-337	3
α-helix	338-348	11
α-helix	353-355	3
β-strand	357-358	2	1
α-helix	359-365	7
α-helix	368-371	4

Chain D: 11 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	2-11	10	4
α-helix	13-17	5
α-helix	19-29	11
β-strand	34-40	7	4
α-helix	46-55	10
β-strand	64-67	4	4
β-strand	71	1	8
β-strand	78	1	8
β-strand	79-84	6	4
β-strand	89-96	8	9
β-strand	114-120	7	9
β-strand	127-134	8	9
α-helix	137-139	3
α-helix	140-158	19
β-strand	163-168	6	9
α-helix	181-183	3
α-helix	185-188	4
β-strand	193-194	2	9
β-strand	203	1	10
β-strand	212-217	6	9
α-helix	219-224	6
β-strand	225	1	11
α-helix	226	1
β-strand	231-232	2	4
α-helix	235-238	4
α-helix	243-249	7
β-strand	252	1	10
β-strand	255-258	4	4
β-strand	259	1	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin	A	protein	373	Oryctolagus cuniculus	P68135 (AlphaFold model)
Deoxyribonuclease I	D	protein	260	Bos taurus	P00639 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ATN_1 ACTIN (chains A)
XDEDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKM
TQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLD
LAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKS
YELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVM
SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITK
QEYDEAGPSIVHR

Sequence of entity 2 (D), FASTA

>1ATN_2 DEOXYRIBONUCLEASE I (chains D)
LKIAAFNIRTFGETKMSNATLASYIVRIVRRYDIVLIQEVRDSHLVAVGKLLDYLNQDDP
NTYHYVVSEPLGRNSYKERYLFLFRPNKVSVLDTYQYDDGCGNCGNDSFSREPAVVKFSS
HSTKVKEFAIVALHSAPSDAVAEINSLYDVYLDVQQKWHLNDVMLMGDFNADCSYVTSSQ
WSSIRLRTSSTFQWLIPDSADTTATSTNCAYDRIVVAGSLLQSSVVPGSAAPFDFQAAYG
LSNEMALAISDHYPVEVTLT

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1

Primary citation

Atomic structure of the actin:DNase I complex. Kabsch, W., Mannherz, H.G., Suck, D. et al. Nature (1990) 347:37-44. DOI 10.1038/347037a0 · PubMed

Other PDB entries of the same protein (UniProt P68135 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4B1Y 1.29 Å, Structure of the Phactr1 RPEL-3 bound to G-actin
2FXU 1.35 Å, X-ray Structure of Bistramide A- Actin Complex at 1.35 A resolution.
4K41 1.4 Å, Crystal structure of actin in complex with marine macrolide kabiramide C
1QZ5 1.45 Å, Structure of rabbit actin in complex with kabiramide C
1WUA 1.45 Å, The structure of Aplyronine A-actin complex
2Q0U 1.45 Å, Structure of Pectenotoxin-2 and Latrunculin B Bound to Actin
2V52 1.45 Å, Structure of MAL-RPEL2 complexed to G-actin
3MN5 1.5 Å, Structures of actin-bound WH2 domains of Spire and the implication for filament nucleation
2PBD 1.5 Å, Ternary complex of profilin-actin with the poly-PRO-GAB domain of VASP*
5ZZA 1.53 Å, OdinProfilin/Rabbit Actin Complex
1J6Z 1.54 Å, Uncomplexed actin
1QZ6 1.6 Å, Structure of rabbit actin in complex with jaspisamide A

Browse more

1ATN is part of these collections:

Motor proteins and the cytoskeleton

About this viewer

MolViewer shows 1ATN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.