Crystal structure of OMTKY3-CH2-ASP19I. Determined by X-ray diffraction at 1.65 Å resolution. Released 31 Jan 2001.
Explore 1DS3 in 3D Show helices and sheets RCSB PDB PDBe
1DS3 contains 1 α-helix and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 23-25 | 3 | 1 |
| β-strand | 30-31 | 2 | 1 |
| α-helix | 34-43 | 10 | |
| β-strand | 50-53 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ovomucoid | I | protein | 51 | Meleagris gallopavo | P68390 (AlphaFold model) |
>1DS3_1 OVOMUCOID (chains I) VDCSEYPKPACTXDYRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Contribution of peptide bonds to inhibitor-protease binding: crystal structures of the turkey ovomucoid third domain backbone variants OMTKY3-Pro18I and OMTKY3-psi[COO]-Leu18I in complex with Streptomyces griseus proteinase B (SGPB) and the structure of the free inhibitor,…. Bateman, K.S., Huang, K., Anderson, S. et al. J Mol Biol (2001) 305:839-849. DOI 10.1006/jmbi.2000.4343 · PubMed
Other PDB entries of the same protein (UniProt P68390 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1DS3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.