1DT7: S100 calcium-binding protein

Solution structure of the C-terminal negative regulatory domain of P53 in a complex with CA2+-bound S100B(BB). Determined by solution NMR. Released 26 Jul 2000.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 4
Atoms: 1,856
Mol. weight: 26.87 kDa
Ligands: CA
Released: 26 Jul 2000

Explore 1DT7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1DT7 contains 14 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	3-18	16
β-strand	26-28	3	1
α-helix	29-33	5
α-helix	34-39	6
α-helix	50-60	11
β-strand	67-69	3	1
α-helix	70-87	18

Chains X and Y: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	101-103	3
α-helix	104-109	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S100 calcium-binding protein	A, B	protein	92	Rattus norvegicus	P04631 (AlphaFold model)
Cellular tumor antigen P53	X, Y	protein	22		P04637 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1DT7_1 S100 CALCIUM-BINDING PROTEIN (chains A, B)
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
LDEDGDGECDFQEFMAFVSMVTTACHEFFEHE

Sequence of entity 2 (X, Y), FASTA

>1DT7_2 CELLULAR TUMOR ANTIGEN P53 (chains X, Y)
SHLKSKKGQSTSRHKKLMFKTE

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Primary citation

Structure of the negative regulatory domain of p53 bound to S100B(betabeta). Rustandi, R.R., Baldisseri, D.M., Weber, D.J. Nat Struct Biol (2000) 7:570-574. DOI 10.1038/76797 · PubMed

Other PDB entries of the same protein (UniProt P04631 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1B4C Solution structure of rat apo-S100B using dipolar couplings
1MWN Solution NMR structure of S100B bound to the high-affinity target peptide TRTK-12
1QLK Solution structure of CA(2+)-loaded rat S100B (betabeta) NMR, 20 structures
1SYM 3-D solution structure of reduced apo-S100B from rat, NMR, 20 structures
1XYD NMR Solution Structure of Rat Zinc-Calcium-S100B, 20 Structures
2K7O Ca2+-S100B, refined with RDCs

Browse structure collections

About this viewer

MolViewer shows 1DT7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.