1SYM: S100B

3-D solution structure of reduced apo-S100B from rat, NMR, 20 structures. Determined by solution NMR. Released 7 Dec 1996.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 2
Atoms: 1,502
Mol. weight: 21.52 kDa
Released: 7 Dec 1996

Explore 1SYM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1SYM contains 16 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
α-helix	4-8	5
α-helix	9-13	5
α-helix	14-18	5
β-strand	27-28	2	1
α-helix	29-34	6
α-helix	35-40	6
α-helix	50-63	14
β-strand	67-68	2	1
α-helix	70-81	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S100B	A, B	protein	92	Rattus norvegicus	P04631 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1SYM_1 S100B (chains A, B)
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
LDEDGDGECDFQEFMAFVSMVTTACHEFFEHE

Primary citation

Solution structure of rat apo-S100B(beta beta) as determined by NMR spectroscopy. Drohat, A.C., Amburgey, J.C., Abildgaard, F. et al. Biochemistry (1996) 35:11577-11588. DOI 10.1021/bi9612226 · PubMed

Other PDB entries of the same protein (UniProt P04631 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1B4C Solution structure of rat apo-S100B using dipolar couplings
1DT7 Solution structure of the C-terminal negative regulatory domain of P53 in a complex with…
1MWN Solution NMR structure of S100B bound to the high-affinity target peptide TRTK-12
1QLK Solution structure of CA(2+)-loaded rat S100B (betabeta) NMR, 20 structures
1XYD NMR Solution Structure of Rat Zinc-Calcium-S100B, 20 Structures
2K7O Ca2+-S100B, refined with RDCs

Browse structure collections

About this viewer

MolViewer shows 1SYM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.