1XYD: Rat Zinc-Calcium-S100B, 20 Structures

NMR Solution Structure of Rat Zinc-Calcium-S100B, 20 Structures. Determined by solution NMR. Released 7 Jun 2005.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 2
Atoms: 1,508
Mol. weight: 21.81 kDa
Ligands: ZN, CA
Released: 7 Jun 2005

Explore 1XYD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1XYD contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	2-18	17
α-helix	29-38	10
α-helix	50-60	11
α-helix	70-86	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
S-100 protein, beta chain	A, B	protein	92	Rattus norvegicus	P04631 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1XYD_1 S-100 protein, beta chain (chains A, B)
MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMET
LDEDGDGECDFQEFMAFVSMVTTACHEFFEHE

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2
CA	Calcium ion	Ca	4

Primary citation

Solution Structure of Zinc- and Calcium-Bound Rat S100B as Determined by Nuclear Magnetic Resonance Spectroscopy. Wilder, P.T., Varney, K.M., Weiss, M.B. et al. Biochemistry (2005) 44:5690-5702. DOI 10.1021/bi0475830 · PubMed

Other PDB entries of the same protein (UniProt P04631 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1B4C Solution structure of rat apo-S100B using dipolar couplings
1DT7 Solution structure of the C-terminal negative regulatory domain of P53 in a complex with…
1MWN Solution NMR structure of S100B bound to the high-affinity target peptide TRTK-12
1QLK Solution structure of CA(2+)-loaded rat S100B (betabeta) NMR, 20 structures
1SYM 3-D solution structure of reduced apo-S100B from rat, NMR, 20 structures
2K7O Ca2+-S100B, refined with RDCs

Browse structure collections

About this viewer

MolViewer shows 1XYD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.