1DUG: PDB entry 1DUG

Structure of the fibrinogen G chain integrin binding and factor xiiia crosslinking sites obtained through carrier protein driven crystallization. Determined by X-ray diffraction at 1.8 Å resolution. Released 2 Feb 2000.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Schistosoma japonicum, Homo sapiens
Chains: 2
Atoms: 4,520
Mol. weight: 54.88 kDa
Ligands: GSH
Released: 2 Feb 2000

Explore 1DUG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1DUG contains 19 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
α-helix	11-13	3
α-helix	14-23	10
β-strand	28-32	5	1
α-helix	33	1
α-helix	37-43	7
β-strand	56-58	3	1
β-strand	63-65	3	1
α-helix	67-77	11
α-helix	85-109	25
α-helix	114-135	22
β-strand	141	1	2
β-strand	144	1	2
α-helix	149-164	16
α-helix	173-184	12
α-helix	186-192	7

Chain B: 9 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	3
α-helix	11-13	3
α-helix	14-22	9
β-strand	28-32	5	3
α-helix	37-43	7
β-strand	56-59	4	3
β-strand	62-65	4	3
α-helix	67-77	11
α-helix	85-109	25
α-helix	114-135	22
β-strand	141	1	4
β-strand	144	1	4
α-helix	149-164	16
α-helix	173-184	12
α-helix	186-192	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
chimera of GLUTATHIONE S-TRANSFERASE-synthetic LINKEr-C-TERMINAL FIBRINOGEN GAMMA CHAIN	A, B	protein	234	Schistosoma japonicum, Homo sapiens	P02679 (AlphaFold model), P08515 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1DUG_1 chimera of GLUTATHIONE S-TRANSFERASE-synthetic LINKEr-C-TERMINAL FIBRINOGEN GAMMA CHAIN (chains A, B)
SPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDG
DVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVD
FLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKK
RIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDPQQHHLGGAKQAGDV

Ligands and cofactors

ID	Name	Formula	Copies
GSH	Glutathione	C10 H17 N3 O6 S	2

Primary citation

Structure of the fibrinogen gamma-chain integrin binding and factor XIIIa cross-linking sites obtained through carrier protein driven crystallization. Ware, S., Donahue, J.P., Hawiger, J. et al. Protein Sci (1999) 8:2663-2671. PubMed

Other PDB entries of the same protein (UniProt P02679 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9KHB 1.03 Å, Crystal structure of wild-type human fibrinogen gamma chain C-terminal domain…
9KHC 1.32 Å, Crystal structure of wild-type human fibrinogen gamma chain C-terminal domain…
2Y7L 1.49 Å, Structure of N-terminal domain of Candida albicans Als9-2 in complex with human…
4B60 1.83 Å, Structure of rFnBPA(189-505) in complex with fibrinogen gamma chain C- terminal peptide
2VR3 1.95 Å, Structural and Biochemical Characterization of Fibrinogen binding to ClfA from…
2FIB 2.01 Å, Recombinant human gamma-fibrinogen carboxyl terminal fragment (residues 143-411)…
1FIB 2.1 Å, Recombinant human gamma-fibrinogen carboxyl terminal fragment (residues 143-411) bound…
1FID 2.1 Å, Structure of human gamma fibrinogen 30 kd carboxyl terminal fragment
3FIB 2.1 Å, Recombinant human gamma-fibrinogen carboxyl terminal fragment (residues 143-411) bound…
1FZC 2.3 Å, Crystal structure of fragment double-D from human fibrin with two different bound ligands
3E1I 2.3 Å, Crystal Structure of BbetaD432A Variant Fibrinogen Fragment D with the Peptide Ligand…
2HWL 2.4 Å, Crystal structure of thrombin in complex with fibrinogen gamma' peptide

Browse structure collections

About this viewer

MolViewer shows 1DUG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.