2Y7L: N-terminal domain of Candida albicans Als9-2

Structure of N-terminal domain of Candida albicans Als9-2 in complex with human fibrinogen gamma peptide. Determined by X-ray diffraction at 1.49 Å resolution. Released 5 Oct 2011.

Method: X-ray diffraction
Resolution: 1.49 Å
Organisms: CANDIDA ALBICANS, HOMO SAPIENS
Chains: 2
Atoms: 2,739
Mol. weight: 35.29 kDa
Released: 5 Oct 2011

Explore 2Y7L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2Y7L contains 7 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
β-strand	7-15	9	2
α-helix	22-23	2
β-strand	31-40	10	2
β-strand	49-55	7	1
β-strand	57-60	4	2
β-strand	66-71	6	1
β-strand	74-82	9	1
β-strand	90-97	8	1
α-helix	98-99	2
β-strand	106-117	12	2
α-helix	125-130	6
β-strand	137-145	9	1
β-strand	148-156	9	1
α-helix	157-159	3
β-strand	167-173	7	3
α-helix	174-176	3
β-strand	178-184	7	3
α-helix	185-187	3
β-strand	192-201	10	4
β-strand	205-218	14	3
β-strand	220	1	5
β-strand	226	1	5
β-strand	230	1	3
β-strand	234-238	5	4
β-strand	242-247	6	4
β-strand	250	1	4
β-strand	254-264	11	3
β-strand	269-274	6	4
β-strand	277-280	4	4
β-strand	285-287	3	4
β-strand	290-295	6	4
α-helix	296-299	4
β-strand	303-309	7	2

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	13-16	4	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Agglutinin-like ALS9 protein	A	protein	312	CANDIDA ALBICANS	A0A1D8PQ86 (AlphaFold model)
Fibrinogen gamma chain, isoform cra_a	B	protein	17	HOMO SAPIENS	P02679 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2Y7L_1 AGGLUTININ-LIKE ALS9 PROTEIN (chains A)
RKTITGVFNSFDSLTWTRSVEYVYKGPETPTWNAVLGWSLNSTTADPGDTFTLILPCVFK
FITTQTSVDLTADGVSYATCDFNAGEEFTTFSSLSCTVNSVSVSYARVSGTVKLPITFNV
GGTGSSVDLADSKCFTAGKNTVTFMDGDTKISTTVDFDASPVSPSGYITSSRIIPSLNKL
SSLFVVPQCENGYTSGIMGFVASNGATIDCSNVNIGISKGLNDWNFPVSSESFSYTKTCT
STSITVEFQNVPAGYRPFVDAYISAENIDKYTLTYANEYTCENGNTVVDPFTLTWWGYKN
SEADSDGDVIVV

Sequence of entity 2 (B), FASTA

>2Y7L_2 FIBRINOGEN GAMMA CHAIN, ISOFORM CRA_A (chains B)
GEGQQHHLGGAKQAGDV

Primary citation

Structural Basis for the Broad Specificity to Host- Cell Ligands by the Pathogenic Fungus Candida Albicans. Salgado, P.S., Yan, R., Taylor, J.D. et al. Proc Natl Acad Sci U S A (2011) 108:15775. DOI 10.1073/PNAS.1103496108 · PubMed

Other PDB entries of the same protein (UniProt A0A1D8PQ86 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2YLH 1.7 Å, Structure of N-terminal domain of Candida albicans Als9-2 G299W mutant
2Y7O 1.75 Å, Structure of N-terminal domain of Candida albicans als9-2 - G299W mutant
2Y7M 1.98 Å, Structure of N-terminal domain of Candida albicans als9-2 (Pt derivative)
2Y7N 2.0 Å, Structure of N-terminal domain of Candida albicans als9-2 - Apo Form

Browse structure collections

About this viewer

MolViewer shows 2Y7L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.