Solution structure of the a-subunit of human chorionic gonadotropin [modeled without carbohydrate residues]. Determined by solution NMR. Released 29 Feb 2000.
Explore 1DZ7 in 3D Show helices and sheets RCSB PDB PDBe
1DZ7 contains 1 α-helix and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 20 | 1 | 1 |
| β-strand | 23 | 1 | 1 |
| β-strand | 59-60 | 2 | 2 |
| β-strand | 64 | 1 | 3 |
| α-helix | 71-73 | 3 | |
| β-strand | 81 | 1 | 3 |
| β-strand | 84-85 | 2 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chorionic gonadotropin | A | protein | 92 | HOMO SAPIENS | P01215 (AlphaFold model) |
>1DZ7_1 CHORIONIC GONADOTROPIN (chains A) APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
Solution structure of the alpha-subunit of human chorionic gonadotropin. Erbel, P.J., Karimi-Nejad, Y., De Beer, T. et al. Eur J Biochem (1999) 260:490-498. DOI 10.1046/j.1432-1327.1999.00188.x · PubMed
Other PDB entries of the same protein (UniProt P01215 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1DZ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.