NMR structure of the C10S mutant of enzyme iib cellobiose of the phosphoenol-pyruvate dependent phosphotransferase system of escherichia coli, 17 structures. Determined by solution NMR. Released 23 Jul 1997.
Explore 1E2B in 3D Show helices and sheets RCSB PDB PDBe
1E2B contains 6 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-9 | 6 | 1 |
| α-helix | 17-29 | 13 | |
| β-strand | 34-39 | 6 | 1 |
| α-helix | 46-50 | 5 | |
| β-strand | 53-56 | 4 | 1 |
| α-helix | 61-63 | 3 | |
| α-helix | 64-70 | 7 | |
| β-strand | 78 | 1 | 1 |
| α-helix | 81-84 | 4 | |
| α-helix | 91-101 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Enzyme iib-cellobiose | A | protein | 106 | Escherichia coli | P69795 (AlphaFold model) |
>1E2B_1 ENZYME IIB-CELLOBIOSE (chains A) MEKKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQI AYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAAN
The NMR side-chain assignments and solution structure of enzyme IIBcellobiose of the phosphoenolpyruvate-dependent phosphotransferase system of Escherichia coli. Ab, E., Schuurman-Wolters, G., Reizer, J. et al. Protein Sci (1997) 6:304-314. PubMed
Other PDB entries of the same protein (UniProt P69795 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1E2B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.