2WY2: PDB entry 2WY2

Name: PDB 2WY2: NMR structure of the IIAchitobiose-IIBchitobiose phosphoryl transition state complex of the N,N'-diacetylchitoboise brance of the E. coli phosphotransferase system.
Published: 2009-12-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

NMR structure of the IIAchitobiose-IIBchitobiose phosphoryl transition state complex of the N,N'-diacetylchitoboise brance of the E. coli phosphotransferase system. Determined by solution NMR. Released 8 Dec 2009.

Method: Solution NMR
Organism: ESCHERICHIA COLI
Chains: 4
Atoms: 3,129
Mol. weight: 44.91 kDa
Ligands: PO3
Released: 8 Dec 2009

Explore 2WY2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2WY2 contains 17 α-helices and 4 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2-30	29
α-helix	34-60	27
α-helix	73-100	28

Chain D: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	1
α-helix	15-29	15
β-strand	34-40	7	1
α-helix	41-43	3
α-helix	44-48	5
β-strand	53-56	4	1
α-helix	58-63	6
α-helix	64-70	7
β-strand	76-78	3	1
α-helix	79-80	2
α-helix	81-85	5
α-helix	89-104	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
N\,n'-diacetylchitobiose-specific phosphotransferase enzyme iia component	A, B, C	protein	103	ESCHERICHIA COLI	P69791 (AlphaFold model)
N\,n'-diacetylchitobiose-specific phosphotransferase enzyme iib component	D	protein	103	ESCHERICHIA COLI	P69795 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2WY2_1 N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIA COMPONENT (chains A, B, C)
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIE
GDAGEGKMKVSLVLVHAQLHLMTSMLARELITELIELHEKLKA

Sequence of entity 2 (D), FASTA

>2WY2_2 N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME IIB COMPONENT (chains D)
KKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAY
MLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Ligands and cofactors

ID	Name	Formula	Copies
PO3	Phosphite ion	O3 P	1

Primary citation

Solution Structure of the Iiachitobose-Iibchitobiose Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia Coli Phosphotransfer System. Jung, Y.S., Cai, M., Clore, G.M. J Biol Chem (2010) 285:4173. DOI 10.1074/JBC.M109.080937 · PubMed

Other PDB entries of the same protein (UniProt P69791 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WCR Trimeric Structure of the Enzyme IIA from Escherichia coli Phosphotransferase System…
2LRK Solution Structures of the IIA(Chitobiose)-HPr complex of the N,N'-Diacetylchitobiose
2LRL Solution Structures of the IIA(Chitobiose)-HPr complex of the N,N'-Diacetylchitobiose…
2WWV NMR structure of the IIAchitobiose-IIBchitobiose complex of the N,N'- diacetylchitoboise…

Browse structure collections

About this viewer

MolViewer shows 2WY2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.