NMR structure of cysteinyl-phosphorylated enzyme IIB of the N,N'-diacetylchitobiose specific phosphoenolpyruvate-dependent phosphotransferase system of Escherichia coli. Determined by solution NMR. Released 21 May 2001.
Explore 1H9C in 3D Show helices and sheets RCSB PDB PDBe
1H9C contains 8 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-10 | 7 | 1 |
| α-helix | 17-29 | 13 | |
| β-strand | 34-40 | 7 | 1 |
| α-helix | 41-43 | 3 | |
| α-helix | 44-48 | 5 | |
| β-strand | 53-56 | 4 | 1 |
| α-helix | 58-63 | 6 | |
| α-helix | 64-70 | 7 | |
| β-strand | 76-78 | 3 | 1 |
| α-helix | 79-80 | 2 | |
| α-helix | 81-86 | 6 | |
| α-helix | 89-104 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Pts system, chitobiose-specific iib component | A | protein | 106 | ESCHERICHIA COLI | P69795 (AlphaFold model) |
>1H9C_1 PTS SYSTEM, CHITOBIOSE-SPECIFIC IIB COMPONENT (chains A) MEKKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQI AYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAAN
NMR Structure of Cysteinyl-Phosphorylated Enzyme Iib of the N,N'-Diacetylchitobiose Specific Phosphoenolpyruvate-Dependentphosphotransferase System of Escherichia Coli. Ab, E., Schuurman-Wolters, G.K., Nijlant, D. et al. J Mol Biol (2001) 308:993-1009. DOI 10.1006/JMBI.2001.4623 · PubMed
Other PDB entries of the same protein (UniProt P69795 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1H9C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.