3EIP: Protein

Crystal structure of colicin E3 immunity protein: an inhibitor to a ribosome-inactivating RNase. Determined by X-ray diffraction at 1.8 Å resolution. Released 10 Nov 1999.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Escherichia coli str. K12 substr.
Chains: 2
Atoms: 1,505
Mol. weight: 19.62 kDa
Ligands: ZN
Released: 10 Nov 1999

Explore 3EIP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3EIP contains 12 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-10	9	1
β-strand	16-21	6	1
α-helix	30-33	4
α-helix	39-42	4
β-strand	47-49	3	1
α-helix	50-51	2
α-helix	52-54	3
α-helix	55-58	4
α-helix	59-61	3
β-strand	71-79	9	1

Chain B: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-10	9	2
β-strand	16-21	6	2
α-helix	30-35	6
α-helix	40-42	3
β-strand	47-49	3	2
α-helix	50-51	2
α-helix	52-54	3
α-helix	55-58	4
α-helix	59-61	3
β-strand	71-79	9	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (colicin E3 immunity protein)	A, B	protein	84	Escherichia coli str. K12 substr.	P02984 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>3EIP_1 PROTEIN (COLICIN E3 IMMUNITY PROTEIN) (chains A, B)
GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQP
YFNHQIDISDNEYFVSFDYRDGDW

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Crystal structure of colicin E3 immunity protein: an inhibitor of a ribosome-inactivating RNase. Li, C., Zhao, D., Djebli, A. et al. Structure (1999) 7:1365-1372. DOI 10.1016/S0969-2126(00)80026-X · PubMed

Other PDB entries of the same protein (UniProt P02984 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2B5U 2.3 Å, Crystal Structure Of Colicin E3 V206C Mutant In Complex With Its Immunity Protein
1E44 2.4 Å, ribonuclease domain of colicin E3 in complex with its immunity protein
4UDM 2.96 Å, Crystal structure of Im3 in complex with Y52A mutant of E3RNase
1JCH 3.02 Å, Crystal Structure of Colicin E3 in Complex with its Immunity Protein

Browse structure collections

About this viewer

MolViewer shows 3EIP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.