1E4J: Soluble human Fc-gamma Receptor III

Crystal structure of the soluble human Fc-gamma Receptor III. Determined by X-ray diffraction at 2.5 Å resolution. Released 4 Aug 2000.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 1,443
Mol. weight: 20.12 kDa
Released: 4 Aug 2000

Explore 1E4J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1E4J contains 5 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
β-strand	6-10	5	2
β-strand	15-17	3	3
β-strand	22-27	6	2
β-strand	31	1	4
β-strand	34	1	4
β-strand	38-41	4	5
β-strand	44-45	2	5
β-strand	52-55	4	2
α-helix	60-62	3
β-strand	64-69	6	5
β-strand	74	1	1
α-helix	75-78	4
β-strand	79-81	3	5
β-strand	82-84	3	3
β-strand	88-91	4	6
β-strand	96-97	2	7
β-strand	103-105	3	8
β-strand	106-109	4	6
α-helix	110	1
β-strand	116-122	7	9
β-strand	125-132	8	9
β-strand	136-138	3	8
α-helix	143-145	3
β-strand	147-155	9	9
β-strand	158-161	4	9
α-helix	162-164	3
β-strand	165-167	3	9
β-strand	168-169	2	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Low affinity immunoglobulin gamma fc receptor III	A	protein	176	HOMO SAPIENS	O75015 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1E4J_1 LOW AFFINITY IMMUNOGLOBULIN GAMMA FC RECEPTOR III (chains A)
MRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFID
AATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALH
KVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQG

Primary citation

The 3.2-A Crystal Structure of the Human Igg1 Fc Fragment-Fc Gammariii Complex. Sondermann, P., Huber, R., Oosthuizen, V. et al. Nature (2000) 406:267. DOI 10.1038/35018508 · PubMed

Other PDB entries of the same protein (UniProt O75015 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FNL 1.8 Å, Crystal structure of the extracellular domain of a human fcgriii
6EAQ 2.22 Å, Glycosylated FCGR3B / CD16b in complex with afucosylated IgG1 Fc
1T83 3.0 Å, Crystal structure of a human type III fc gamma receptor in complex with an fc fragment…
1E4K 3.2 Å, Crystal structure of soluble human IgG1 fc fragment-fc-gamma receptor III complex
1T89 3.5 Å, Crystal structure of a human type III fc gamma receptor in complex with an fc fragment…

Browse structure collections

About this viewer

MolViewer shows 1E4J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.