1E4K: Fc fragment of human IgG1

Crystal structure of soluble human IgG1 fc fragment-fc-gamma receptor III complex. Determined by X-ray diffraction at 3.2 Å resolution. Released 6 Aug 2000.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: HOMO SAPIENS
Chains: 3
Atoms: 5,042
Mol. weight: 74.1 kDa
Released: 6 Aug 2000

Explore 1E4K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1E4K contains 16 α-helices and 60 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	237-239	3
β-strand	240-243	4	1
α-helix	248-250	3
β-strand	258-266	9	1
β-strand	274-279	6	2
β-strand	300-307	8	1
α-helix	310-315	6
β-strand	319-324	6	2
β-strand	332-336	5	2
β-strand	344	1	3
β-strand	347-351	5	4
α-helix	355-358	4
β-strand	362-372	11	4
β-strand	373	1	3
β-strand	378-382	5	5
β-strand	387	1	5
α-helix	388	1
β-strand	392-393	2	4
α-helix	394-396	3
β-strand	397-398	2	4
β-strand	404-413	10	4
α-helix	414-419	6
β-strand	423-428	6	5
β-strand	436-441	6	5

Chain B: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	240-243	4	6
α-helix	248-250	3
β-strand	258-266	9	6
β-strand	273-279	7	7
β-strand	294	1	8
β-strand	300	1	6
β-strand	301	1	8
β-strand	302-307	6	6
α-helix	310-315	6
β-strand	318-325	8	7
β-strand	332-337	6	7
β-strand	344	1	9
β-strand	347-351	5	10
α-helix	355-357	3
β-strand	362-372	11	10
β-strand	373	1	9
β-strand	378-382	5	11
β-strand	387	1	11
α-helix	388	1
β-strand	392-393	2	10
α-helix	394-396	3
β-strand	397-398	2	10
β-strand	404-413	10	10
α-helix	414-419	6
β-strand	423-428	6	11
β-strand	436-441	6	11

Chain C: 3 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	7-10	4	12
β-strand	15-17	3	13
β-strand	22-26	5	12
β-strand	31	1	14
β-strand	34	1	14
β-strand	37-41	5	15
β-strand	45-46	2	15
β-strand	52-55	4	12
α-helix	60-62	3
β-strand	64-70	7	15
β-strand	75	1	15
β-strand	79-81	3	15
β-strand	82-84	3	13
β-strand	88-91	4	16
β-strand	96-98	3	17
β-strand	103-105	3	18
β-strand	106-109	4	16
α-helix	110-112	3
β-strand	116-122	7	19
β-strand	128-130	3	19
β-strand	136-138	3	18
β-strand	147-155	9	19
β-strand	158-161	4	19
α-helix	162-164	3
β-strand	165-167	3	19
β-strand	168-170	3	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fc fragment of human IgG1	A, B	protein	225	HOMO SAPIENS	P01857 (AlphaFold model)
Low affinity immunoglobulin gamma fc receptor III	C	protein	176	HOMO SAPIENS	O75015 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1E4K_1 FC FRAGMENT OF HUMAN IGG1 (chains A, B)
THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPQVKFNWYVDGV
QVHNAKTKPREQQYNSTYRVVSVLTVLHQNWLDGKEYKCKVSNKALPAPIEKTISKAKGQ
PREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG
SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Sequence of entity 2 (C), FASTA

>1E4K_2 LOW AFFINITY IMMUNOGLOBULIN GAMMA FC RECEPTOR III (chains C)
MRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFID
AATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALH
KVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQG

Primary citation

The 3.2A Crystal Structure of the Human Igg1 Fc Fragment-Fc-Gamma-Riii Complex. Sondermann, P., Huber, R., Oosthuizen, V. et al. Nature (2000) 406:267. DOI 10.1038/35018508 · PubMed

Other PDB entries of the same protein (UniProt P01857 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4LLD 1.19 Å, Structure of wild-type IgG1 antibody heavy chain constant domain 1 and light chain…
3TV3 1.29 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT128 in complex with…
4LLQ 1.42 Å, Structure of redesigned IgG1 first constant and lambda domains (CH1:Clambda constant…
5HSF 1.52 Å, 1.52 Angstrom Crystal Structure of Fc fragment of Human IgG1.
6YT7 1.55 Å, Glycosylated knob/dummy-hole fc fragment
4NWU 1.6 Å, Crystal structure of APE1551, an anti-human NGF Fab with a nine amino acid insertion in…
1L6X 1.65 Å, Fc fragment of rituximab bound to a minimized version of the B-domain from protein A…
3TWC 1.65 Å, Crystal structure of broad and potent HIV-1 neutralizing antibody PGT127 in complex with…
5JIH 1.66 Å, Crystal structure of HER2 binding IgG1-Fc (Fcab STAB19)
3MCL 1.7 Å, Anti-beta-amyloid antibody c706 fab in space group P21
5U66 1.7 Å, Modified single helix from the B-domain of protein A bound to IgG1 Fc
6N35 1.75 Å, Anti-HIV-1 Fab 2G12 + Man1-2 re-refinement

Browse more

1E4K is part of these collections:

Antibodies and the immune system

About this viewer

MolViewer shows 1E4K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.