1E5W: Moesin

Structure of isolated FERM domain and first long helix of moesin. Determined by X-ray diffraction at 2.7 Å resolution. Released 27 Jun 2001.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: HOMO SAPIENS
Chains: 1
Atoms: 2,925
Mol. weight: 41.05 kDa
Released: 27 Jun 2001

Explore 1E5W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1E5W contains 12 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	1
β-strand	16-20	5	1
β-strand	25	1	2
α-helix	26-37	12
α-helix	42-44	3
β-strand	45-50	6	1
β-strand	56-58	3	1
β-strand	64	1	2
α-helix	65-67	3
β-strand	76-82	7	1
α-helix	89-92	4
α-helix	96-111	16
α-helix	119-133	15
α-helix	165-177	13
α-helix	184-195	12
β-strand	204-210	7	3
β-strand	215-221	7	3
β-strand	224-229	6	3
β-strand	236-241	6	3
α-helix	242-244	3
β-strand	245-250	6	3
β-strand	254-259	6	3
β-strand	267-270	4	3
α-helix	274-295	22
α-helix	297-298	2
α-helix	301-343	43

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Moesin	A	protein	346	HOMO SAPIENS	P26038 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1E5W_1 MOESIN (chains A)
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLK
LNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE
TAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHR
GMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEE

Primary citation

The 2.7 A Crystal Structure of the Activated Ferm Domain of Moesin: An Analysis of Structural Changes on Activation. Edwards, S.D., Keep, N.H. Biochemistry (2001) 40:7061. DOI 10.1021/BI010419H · PubMed

Other PDB entries of the same protein (UniProt P26038 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8CIS 1.52 Å, The FERM domain of human moesin with two bound peptides identified by phage display
6TXQ 1.73 Å, The high resolution structure of the FERM domain and helical linker of human moesin
8XZ5 1.8 Å, SARS-CoV-2 S and moesin complex structure
8CIR 1.85 Å, The FERM domain of human moesin with a bound peptide identified by phage display
1EF1 1.9 Å, Crystal structure of the moesin ferm domain/tail domain complex
6TXS 2.2 Å, The structure of the FERM domain and helical linker of human moesin bound to a CD44…
8CIU 2.39 Å, The FERM domain of human moesin mutant H288A
8CIT 2.54 Å, The FERM domain of human moesin mutant L281R
1SGH 3.5 Å, Moesin FERM domain bound to EBP50 C-terminal peptide

Browse structure collections

About this viewer

MolViewer shows 1E5W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.