1E6F: Human MIR-receptor, repeat 11

Name: PDB 1E6F: Human MIR-receptor, repeat 11
Published: 2001-08-09
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: receptor

Human MIR-receptor, repeat 11. Determined by X-ray diffraction at 1.75 Å resolution. Released 9 Aug 2001.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: HOMO SAPIENS
Chains: 2
Atoms: 2,124
Mol. weight: 31.13 kDa
Released: 9 Aug 2001

Explore 1E6F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1E6F contains 8 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	1517-1519	3	1
α-helix	1525	1
β-strand	1526-1528	3	1
α-helix	1530-1532	3
β-strand	1533	1	2
β-strand	1538-1542	5	3
β-strand	1546-1550	5	3
β-strand	1552	1	2
β-strand	1563	1	4
β-strand	1565-1567	3	3
β-strand	1573	1	3
β-strand	1576	1	4
β-strand	1582-1584	3	5
β-strand	1587-1592	6	5
β-strand	1597	1	6
α-helix	1598	1
β-strand	1605	1	6
β-strand	1607-1614	8	5
β-strand	1625-1630	6	5
β-strand	1635-1642	8	5
α-helix	1643-1645	3

Chain B: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	1517-1519	3	7
α-helix	1525	1
β-strand	1526-1528	3	7
α-helix	1530-1532	3
β-strand	1538-1542	5	8
β-strand	1546-1550	5	8
β-strand	1563	1	9
β-strand	1565-1567	3	8
β-strand	1573	1	8
β-strand	1576	1	9
β-strand	1582-1584	3	10
β-strand	1587-1592	6	10
β-strand	1597	1	11
α-helix	1598	1
β-strand	1605	1	11
β-strand	1607-1614	8	10
β-strand	1625-1630	6	10
β-strand	1635-1642	8	10
α-helix	1643-1645	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cation-independent mannose-6-phosphate receptor	A, B	protein	143	HOMO SAPIENS	P11717 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1E6F_1 CATION-INDEPENDENT MANNOSE-6-PHOSPHATE RECEPTOR (chains A, B)
MKSNEHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMSICGENENCPPGVGACF
GQTRISVGKANKRLRYVDQVLQLVYKDGSPCPSKSGLSYKSVISFVCRPEAGPTNRPMLI
SLDKQTCTLFFSWHTPLACEQAT

Primary citation

Locating the Anomalous Scatterer Substructures in Halide and Sulfur Phasing. Uson, I., Schmidt, B., Von Buelow, R. et al. Acta Crystallogr D Biol Crystallogr (2003) 59:57. DOI 10.1107/S090744490201884X · PubMed

Other PDB entries of the same protein (UniProt P11717 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1GP0 1.4 Å, Human IGF2R domain 11
6Z30 1.5 Å, Human cation-independent mannose 6-phosphate/ IGF2 receptor domains 9-10
1GQB 1.8 Å, Human mir-receptor, repeat 11
1GP3 1.95 Å, Human IGF2R domain 11
1JWG 2.0 Å, VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide
6N5X 2.05 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
6N5Y 2.26 Å, Crystal structure of the SNX5 PX domain in complex with the CI-MPR (space group P212121…
1LF8 2.3 Å, Complex of GGA3-VHS Domain and CI-MPR C-terminal Phosphopeptide
1JPL 2.4 Å, GGA3 VHS domain complexed with C-terminal peptide from cation-independent mannose…
6V02 2.46 Å, N-terminal 5 domains of CI-MPR
6P8I 2.54 Å, N-terminal 5 domains of IGFIIR
6Z31 2.56 Å, Human cation-independent mannose 6-phosphate/ IGF2 receptor domain 8

Browse structure collections

About this viewer

MolViewer shows 1E6F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.