1E7K: Spliceosomal 15.5kD protein

Crystal structure of the spliceosomal 15.5kD protein bound to a U4 snRNA fragment. Determined by X-ray diffraction at 2.9 Å resolution. Released 19 Feb 2001.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: HOMO SAPIENS
Chains: 4
Atoms: 2,655
Mol. weight: 42.53 kDa
Released: 19 Feb 2001

Explore 1E7K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1E7K contains 12 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 6 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	13	1	1
α-helix	16-31	16
β-strand	35-37	3	1
α-helix	39-47	9
β-strand	51-57	7	1
α-helix	63-65	3
α-helix	69-76	8
β-strand	80-83	4	1
α-helix	86-92	7
β-strand	101-105	5	1
α-helix	113-126	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
15.5 kd RNA binding protein	A, B	protein	128	HOMO SAPIENS	P55769 (AlphaFold model)
RNA (5'-r(gpcpcpapapupgpapgpgpupupup apupcpcpgpapgpgc(-3')	C, D	RNA	22	HOMO SAPIENS

Sequence of entity 1 (A, B), FASTA

>1E7K_1 15.5 KD RNA BINDING PROTEIN (chains A, B)
MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADA
EPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQ
QSIERLLV

Sequence of entity 2 (C, D), FASTA

>1E7K_2 RNA (5'-R(*GP*CP*CP*AP*AP*UP*GP*AP*GP*GP*UP*UP*UP* AP*UP*CP*CP*GP*AP*GP*G*C(-3') (chains C, D)
GCCAAUGAGGUUUAUCCGAGGC

Primary citation

Crystal Structure of the Spliceosomal 15.5Kd Protein Bound to a U4 Snrna Fragment. Vidovic, I., Nottrott, S., Hartmuth, K. et al. Mol Cell (2000) 6:1331. DOI 10.1016/S1097-2765(00)00131-3 · PubMed

Other PDB entries of the same protein (UniProt P55769 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OZB 2.6 Å, Structure of a human Prp31-15.5K-U4 snRNA complex
8H6L 2.6 Å, Cryo-EM structure of human exon-defined spliceosome in the early B state.
3SIU 2.63 Å, Structure of a hPrp31-15.5K-U4atac 5' stem loop complex, monomeric form
7MQA 2.7 Å, Cryo-EM structure of the human SSU processome, state post-A1
8H6K 2.7 Å, Cryo-EM structure of human exon-defined spliceosome in the mature B state.
6QW6 2.92 Å, Structure of the human U5.U4/U6 tri-snRNP at 2.9A resolution.
8Q7N 3.1 Å, cryo-EM structure of the human spliceosomal B complex protomer (tri-snRNP core region)
8QOZ 3.1 Å, Cryo-EM Structure of Pre-B+5'ss+ATPgammaS Complex (core part)
8QPE 3.1 Å, Cryo-EM Structure of Pre-B-like Complex (core part)
8H6E 3.2 Å, Cryo-EM structure of human exon-defined spliceosome in the late pre-B state.
8H6J 3.25 Å, Cryo-EM structure of human exon-defined spliceosome in the mature pre-B state.
6QX9 3.28 Å, Structure of a human fully-assembled precatalytic spliceosome (pre-B complex).

Browse structure collections

About this viewer

MolViewer shows 1E7K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.