8QPE: Pre-B-like Complex

Cryo-EM Structure of Pre-B-like Complex (core part). Determined by electron microscopy at 3.1 Å resolution. Released 22 May 2024.

Method: Electron microscopy
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 20
Atoms: 54,566
Mol. weight: 1237.15 kDa
Ligands: IHP
Released: 22 May 2024

Explore 8QPE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8QPE contains 318 α-helices and 222 β-strands across 15 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain 7: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	410-412	3	1
β-strand	419-421	3	1
α-helix	422-424	3
α-helix	425-432	8
α-helix	436-449	14
α-helix	453-454	2
α-helix	457-458	2
α-helix	459-472	14

Chain A: 111 helices, 78 β-strands

Element	Residues	Length	Sheet
α-helix	58-62	5
α-helix	63-71	9
α-helix	86-90	5
α-helix	95-104	10
α-helix	106-108	3
β-strand	115-121	7	45
β-strand	127-129	3	45
β-strand	134-135	2	46
α-helix	137-157	21
α-helix	163-165	3
α-helix	174-177	4
α-helix	178-181	4
α-helix	186-191	6
α-helix	201-204	4
β-strand	220	1	47
β-strand	227-229	3	47
α-helix	232-241	10
α-helix	260-269	10
β-strand	294	1	48
α-helix	299-301	3
α-helix	310-315	6
α-helix	317-320	4
α-helix	357-359	3
α-helix	398-405	8
α-helix	409-412	4
β-strand	415-417	3	47
β-strand	419-420	2	46
α-helix	421-423	3
α-helix	428-431	4
α-helix	434-436	3
α-helix	441-459	19
α-helix	463-466	4
α-helix	472-478	7
β-strand	482-488	7	45
α-helix	489-508	20
β-strand	516-518	3	49
β-strand	524-526	3	49
α-helix	532-537	6
α-helix	542-565	24
α-helix	571-583	13
α-helix	585-588	4
α-helix	591-594	4
α-helix	598-616	19
α-helix	631-656	26
α-helix	677-695	19
α-helix	699-701	3
α-helix	702-721	20
α-helix	733-763	31
α-helix	769-797	29
α-helix	803-819	17
α-helix	822-824	3
β-strand	825	1	50
α-helix	826-829	4
α-helix	835-847	13
α-helix	848-850	3
β-strand	856	1	40
α-helix	858-872	15
α-helix	874-887	14
β-strand	894-900	7	51
β-strand	905-910	6	51
α-helix	913-932	20
β-strand	940	1	52
α-helix	948-961	14
β-strand	974-980	7	52
β-strand	989	1	53
α-helix	990-997	8
β-strand	1001	1	50
α-helix	1003-1012	10
β-strand	1016-1019	4	51
β-strand	1022-1025	4	51
β-strand	1028	1	53
α-helix	1037-1062	26
α-helix	1068-1070	3
α-helix	1077-1080	4
β-strand	1085-1090	6	52
β-strand	1094-1099	6	52
α-helix	1103-1116	14
β-strand	1142	1	48
α-helix	1144-1159	16
β-strand	1174-1178	5	52
β-strand	1179	1	54
β-strand	1182	1	54
β-strand	1185-1189	5	55
β-strand	1192-1198	7	55
β-strand	1213-1218	6	55
β-strand	1223-1229	7	55
β-strand	1232	1	55
α-helix	1234-1249	16
α-helix	1256-1273	18
α-helix	1282-1303	22
α-helix	1307-1308	2
α-helix	1314-1317	4
α-helix	1320-1322	3
β-strand	1334-1335	2	56
α-helix	1336	1
α-helix	1337-1339	3
β-strand	1341-1345	5	57
β-strand	1350-1354	5	57
α-helix	1360-1362	3
β-strand	1363-1364	2	56
α-helix	1365-1367	3
α-helix	1368-1371	4
α-helix	1375-1398	24
α-helix	1402	1
β-strand	1403-1404	2	42
α-helix	1419-1423	5
β-strand	1424	1	41
α-helix	1427-1430	4
α-helix	1436-1442	7
α-helix	1443-1445	3
α-helix	1450-1451	2
α-helix	1468-1478	11
α-helix	1480-1486	7
α-helix	1491-1493	3
β-strand	1502-1504	3	31
α-helix	1508-1513	6
α-helix	1520-1526	7
α-helix	1529-1537	9
α-helix	1539-1542	4
β-strand	1553-1554	2	58
α-helix	1555	1
β-strand	1561-1562	2	58
α-helix	1567-1576	10
α-helix	1581-1599	19
β-strand	1606-1611	6	59
β-strand	1629-1639	11	59
α-helix	1640-1642	3
β-strand	1643-1644	2	59
β-strand	1655-1667	13	59
α-helix	1676-1687	12
β-strand	1700-1706	7	59
β-strand	1711-1716	6	59
α-helix	1722-1735	14
α-helix	1738-1751	14
β-strand	1753-1754	2	31
α-helix	1757-1761	5
β-strand	1762-1763	2	44
α-helix	1769-1771	3
β-strand	1777-1781	5	44
β-strand	1787-1792	6	60
β-strand	1798-1803	6	60
β-strand	1805	1	61
β-strand	1808-1810	3	44
β-strand	1816-1821	6	44
β-strand	1822	1	61
α-helix	1824-1827	4
α-helix	1833-1851	19
α-helix	1854-1856	3
β-strand	1860-1863	4	44
α-helix	1866-1868	3
α-helix	1869-1875	7
β-strand	1883-1887	5	44
α-helix	1892-1898	7
α-helix	1900-1908	9
β-strand	1913-1918	6	44
α-helix	1929-1945	17
α-helix	1947-1954	8
α-helix	1973-1995	23
α-helix	2004-2011	8
α-helix	2017-2020	4
α-helix	2021-2030	10
α-helix	2032-2033	2
β-strand	2040-2047	8	28
β-strand	2053-2058	6	28
α-helix	2073-2080	8
α-helix	2085-2088	4
β-strand	2090-2091	2	62
β-strand	2098	1	62
β-strand	2104-2106	3	63
α-helix	2108-2117	10
β-strand	2125-2127	3	62
β-strand	2130	1	64
β-strand	2146	1	62
β-strand	2153	1	65
β-strand	2156	1	65
α-helix	2163-2164	2
β-strand	2173	1	64
β-strand	2177-2179	3	62
α-helix	2188-2189	2
α-helix	2190-2201	12
β-strand	2213-2217	5	62
β-strand	2223-2230	8	62
α-helix	2232-2240	9
α-helix	2253-2255	3
β-strand	2256-2259	4	62
β-strand	2261-2263	3	63
β-strand	2272-2274	3	62
β-strand	2296-2298	3	62
α-helix	2311-2316	6

Chain C: 42 helices, 40 β-strands

Element	Residues	Length	Sheet
α-helix	117-123	7
α-helix	126-128	3
β-strand	129-136	8	2
α-helix	142-153	12
α-helix	164-165	2
α-helix	172-177	6
β-strand	184-188	5	2
β-strand	191	1	3
β-strand	197	1	3
β-strand	199-204	6	2
α-helix	209-211	3
α-helix	212-220	9
β-strand	224-230	7	2
α-helix	237-248	12
β-strand	252-258	7	2
α-helix	262-266	5
α-helix	271-292	22
α-helix	296-298	3
β-strand	307-311	5	2
β-strand	316-318	3	2
α-helix	320-330	11
α-helix	336-340	5
β-strand	348-350	3	4
β-strand	355-357	3	4
α-helix	365-366	2
β-strand	367	1	4
α-helix	368-369	2
α-helix	370-374	5
α-helix	375-385	11
α-helix	392-398	7
α-helix	412-424	13
α-helix	429-436	8
α-helix	439-440	2
α-helix	441-452	12
β-strand	453	1	5
α-helix	460-467	8
β-strand	475-483	9	6
β-strand	490-496	7	6
β-strand	501-502	2	7
β-strand	506-510	5	6
β-strand	523-526	4	6
β-strand	530-534	5	6
β-strand	537-541	5	6
β-strand	543-544	2	7
β-strand	549-552	4	6
β-strand	563-566	4	6
β-strand	577	1	5
α-helix	578-580	3
β-strand	588-594	7	8
α-helix	597-599	3
α-helix	600-613	14
β-strand	618-621	4	8
β-strand	627-631	5	8
α-helix	634-646	13
β-strand	653-655	3	8
α-helix	656-658	3
β-strand	659-660	2	8
α-helix	661-662	2
β-strand	663-666	4	9
β-strand	674-677	4	10
β-strand	684-691	8	10
α-helix	692-693	2
α-helix	696-701	6
α-helix	711-722	12
α-helix	726-729	4
β-strand	732-735	4	10
β-strand	743-747	5	10
α-helix	756-760	5
α-helix	763-775	13
β-strand	783-784	2	9
β-strand	787-795	9	10
α-helix	805-822	18
β-strand	825-838	14	9
α-helix	840-842	3
α-helix	843-851	9
β-strand	856-862	7	9
α-helix	863	1
β-strand	869-876	8	9
α-helix	883-890	8
β-strand	896-906	11	9
α-helix	907	1
α-helix	929-941	13

Chain D: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	11
α-helix	11-20	10
β-strand	25-31	7	11
α-helix	36-48	13
α-helix	51-54	4
β-strand	56-62	7	11
α-helix	70-73	4
β-strand	79-84	6	11
β-strand	89	1	11
β-strand	91-93	3	12
β-strand	102	1	11
α-helix	109-125	17
β-strand	129-131	3	12

Chain F: 5 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	89-98	10
α-helix	105-114	10
α-helix	126-139	14
α-helix	173-201	29
α-helix	204-219	16
β-strand	221-228	8	33
β-strand	234-239	6	34
β-strand	245-250	6	34
β-strand	255-259	5	34
β-strand	265-268	4	34
β-strand	276-281	6	35
β-strand	296-300	5	35
β-strand	305-308	4	35
β-strand	317-319	3	35
β-strand	326-331	6	36
β-strand	337-342	6	36
β-strand	346-351	6	36
β-strand	356-361	6	36
β-strand	368-373	6	37
β-strand	379-384	6	37
β-strand	389-393	5	37
β-strand	399-402	4	37
β-strand	410-415	6	38
β-strand	421-426	6	38
β-strand	431-435	5	38
β-strand	440-445	6	38
β-strand	452-457	6	39
β-strand	464-469	6	39
β-strand	473-478	6	39
β-strand	484-489	6	39
β-strand	497-500	4	33
β-strand	507-510	4	33
β-strand	515-521	7	33

Chain I: 16 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	5-6	2
α-helix	9-11	3
β-strand	12	1	13
β-strand	15	1	13
α-helix	17-20	4
α-helix	23-30	8
α-helix	33-38	6
α-helix	44-52	9
β-strand	57	1	14
β-strand	60-61	2	15
β-strand	66-67	2	15
α-helix	69-79	11
α-helix	81-83	3
α-helix	84-92	9
α-helix	97-110	14
α-helix	113-118	6
α-helix	121-125	5
β-strand	129-133	5	14
β-strand	139-143	5	14
α-helix	144-153	10
β-strand	156-157	2	16
β-strand	160-161	2	16
α-helix	162-164	3
α-helix	168-174	7
α-helix	178-180	3

Chain J: 11 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	442-466	25
α-helix	470-475	6
α-helix	481-484	4
α-helix	486-491	6
α-helix	493-517	25
α-helix	522-532	11
β-strand	541-548	8	30
α-helix	554-566	13
β-strand	570-575	6	30
β-strand	580-586	7	30
α-helix	588-596	9
α-helix	597-601	5
β-strand	630-638	9	30
β-strand	649-650	2	30
α-helix	654-663	10
α-helix	667-682	16

Chain K: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	271-299	29

7 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
U4 snRNA	4	RNA	144	Homo sapiens
U5 snRNA	5	RNA	117	Homo sapiens
U6 snRNA	6	RNA	106	Homo sapiens
Splicing factor 3A subunit 1	7	protein	793	Homo sapiens	Q15459 (AlphaFold model)
116 kDa U5 small nuclear ribonucleoprotein component	C	protein	972	Homo sapiens	Q15029 (AlphaFold model)
Thioredoxin-like protein 4A	D	protein	142	Homo sapiens	P83876 (AlphaFold model)
Pre-mRNA-splicing factor 38A	I	protein	312	Homo sapiens	Q8NAV1 (AlphaFold model)
Microfibrillar-associated protein 1	K	protein	439	Homo sapiens	P55081
NHP2-like protein 1, N-terminally processed	M	protein	128	Homo sapiens	P55769
Ubiquitin carboxyl-terminal hydrolase 39	U	protein	565	Homo sapiens	Q53GS9
WW domain-binding protein 4	X	protein	376	Homo sapiens	O75554
Zinc finger matrin-type protein 2	r	protein	199	Homo sapiens	Q96NC0

8 more molecules are not listed.

Sequence of entity 1 (4), FASTA

>8QPE_1 U4 snRNA (chains 4)
AGCUUUGCGCAGUGGCAGUAUCGUAGCCAAUGAGGUCUAUCCGAGGCGCGAUUAUUGCUA
AUUGAAAACUUUUCCCAAUACCCCGCCGUGACGACUUGCAAUAUAGUCGGCACUGGCAAU
UUUUGACAGUCUCUACGGAGACUG

Sequence of entity 2 (5), FASTA

>8QPE_2 U5 snRNA (chains 5)
AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGG
AGAGGAACAACUCUGAGUCUUAACCCAAUUUUUUGAGGCCUUGCUUUGGCAAGGCUA

Sequence of entity 3 (6), FASTA

>8QPE_3 U6 snRNA (chains 6)
GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGC
CCCUGCGCAAGGAUGACACGCAAAUUCGUGAAGCGUUCCAUAUUUU

Sequence of entity 4 (7), FASTA

>8QPE_4 Splicing factor 3A subunit 1 (chains 7)
MPAGPVQAVPPPPPVPTEPKQPTEEEASSKEDSAPSKPVVGIIYPPPEVRNIVDKTASFV
ARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQ
QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQ
FLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVL
DQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTT
PEELGARILIQERYEKFGESEEVEMEVESDEEDDKQEKAEEPPSQLDQDTQVQDMDEGSD
DEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKI
PASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVE
ETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDD
TKEKIGPSKPNEIPQQPPPPSSATNIPSSAPPITSVPRPPTMPPPVRTTVVSAVPVMPRP
PMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMAPRPPPMIVPTAFVPAPPVAP
VPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEW
KLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAV
IHLALKERGGRKK

Sequence of entity 5 (C), FASTA

>8QPE_5 116 kDa U5 small nuclear ribonucleoprotein component (chains C)
MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLH
EDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLA
DLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVG
IKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTE
RLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLIL
SPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKA
PTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVC
KKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK
MYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIE
VNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSEL
PKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVV
TFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQT
KYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLC
DELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPA
DCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSV
FHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLE
LAKQDVVLNYPM

Sequence of entity 6 (D), FASTA

>8QPE_6 Thioredoxin-like protein 4A (chains D)
MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYL
VDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVY
RGARKGRGLVVSPKDYSTKYRY

Sequence of entity 7 (I), FASTA

>8QPE_7 Pre-mRNA-splicing factor 38A (chains I)
MANRTVKDAHSIHGTNPQYLVEKIIRTRIYESKYWKEECFGLTAELVVDKAMELRFVGGV
YGGNIKPTPFLCLTLKMLQIQPEKDIIVEFIKNEDFKYVRMLGALYMRLTGTAIDCYKYL
EPLYNDYRKIKSQNRNGEFELMHVDEFIDELLHSERVCDIILPRLQKRYVLEEAEQLEPR
VSALEEDMDDVESSEEEEEEDEKLERVPSPDHRRRSYRDLDKPRRSPTLRYRRSRSRSPR
RRSRSPKRRSPSPRRERHRSKSPRRHRSRSRDRRHRSRSKSPGHHRSHRHRSHSKSPERS
KKSHKKSRRGNE

Sequence of entity 8 (K), FASTA

>8QPE_8 Microfibrillar-associated protein 1 (chains K)
MSVPSALMKQPPIQSTAGAVPVRNEKGEISMEKVKVKRYVSGKRPDYAPMESSDEEDEEF
QFIKKAKEQEAEPEEQEEDSSSDPRLRRLQNRISEDVEERLARHRKIVEPEVVGESDSEV
EGDAWRMEREDSSEEEEEEIDDEEIERRRGMMRQRAQERKNEEMEVMEVEDEGRSGEESE
SESEYEEYTDSEDEMEPRLKPVFIRKKDRVTVQEREAEALKQKELEQEAKRMAEERRKYT
LKIVEEETKKELEENKRSLAALDALNTDDENDEEEYEAWKVRELKRIKRDREDREALEKE
KAEIERMRNLTEEERRAELRANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDF
SAPTLEDHFNKTILPKVMQVKNFGRSGRTKYTHLVDQDTTSFDSAWGQESAQNTKFFKQK
AAGVRDVFERPSAKKRKTT

Sequence of entity 9 (M), FASTA

>8QPE_9 NHP2-like protein 1, N-terminally processed (chains M)
MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADA
EPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQ
QSIERLLV

Sequence of entity 10 (U), FASTA

>8QPE_10 Ubiquitin carboxyl-terminal hydrolase 39 (chains U)
MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRVKREFEPASAR
EAPASVVPFVRVKREREVDEDSEPEREVRAKNGRVDSEDRRSRHCPYLDTINRSVLDFDF
EKLCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFSHHVFLNLHTLKFYCLPDNYE
IIDSSLEDITYVLKPTFTKQQIANLDKQAKLSRAYDGTTYLPGIVGLNNIKANDYANAVL
QALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEML
QAVVLCSKKTFQITKQGDGVDFLSWFLNALHSALGGTKKKKKTIVTDVFQGSMRIFTKKL
PHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPLYKDEKEQLIIPQVPLFNILA
KFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDL
REYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQ
MITLSEAYIQIWKRRDNDETNQQGA

Sequence of entity 11 (X), FASTA

>8QPE_11 WW domain-binding protein 4 (chains X)
MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEK
ASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEKKEKKKRK
KDPSKGRWVEGITSEGYHYYYDLISGASQWEKPEGFQGDLKKTAVKTVWVEGLSEDGFTY
YYNTETGESRWEKPDDFIPHTSDLPSSKVNENSLGTLDESKSSDSHSDSDGEQEAEEGGV
STETEKPKIKFKEKNKNSDGGSDPETQKEKSIQKQNSLGSNEEKSKTLKKSNPYGEWQEI
KQEVESHEEVDLELPSTENEYVSTSEADGGGEPKVVFKEKTVTSLGVMADGVAPVFKKRR
TENGKSRNLRQRGDDQ

Sequence of entity 12 (r), FASTA

>8QPE_12 Zinc finger matrin-type protein 2 (chains r)
MASGSGTKNLDFRRKWDKDEYEKLAEKRLTEEREKKDGKPVQPVKRELLRHRDYKVDLES
KLGKTIVITKTTPQSEMGGYYCNVCDCVVKDSINFLDHINGKKHQRNLGMSMRVERSTLD
QVKKRFEVNKKKMEEKQKDYDFEERMKELREEEEKAKAYKKEKQKEKKRRAEEDLTFEED
DEMAAVMGFSGFGSTKKSY

Ligands and cofactors

ID	Name	Formula	Copies
IHP	Inositol hexakisphosphate	C6 H18 O24 P6	1

Primary citation

Structural insights into the cross-exon to cross-intron spliceosome switch. Zhang, Z., Kumar, V., Dybkov, O. et al. Nature (2024) 630:1012-1019. DOI 10.1038/s41586-024-07458-1 · PubMed

Other PDB entries of the same protein (UniProt Q15459 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7P0V 1.56 Å, Crystal structure of human SF3A1 ubiquitin-like domain in complex with U1 snRNA…
8ID2 1.8 Å, Crystal structure of the ubiquitin-like domain in the SF3A1 subunit of human U2 snRNP…
7EVO 2.5 Å, The cryo-EM structure of the human 17S U2 snRNP
8H6L 2.6 Å, Cryo-EM structure of human exon-defined spliceosome in the early B state.
8H6K 2.7 Å, Cryo-EM structure of human exon-defined spliceosome in the mature B state.
8HK1 2.7 Å, The cryo-EM structure of human pre-17S U2 snRNP
7VPX 3.0 Å, The cryo-EM structure of the human pre-A complex
8I0R 3.0 Å, The cryo-EM structure of human Bact-I complex
8I0T 3.0 Å, The cryo-EM structure of human Bact-III complex
8Q7N 3.1 Å, cryo-EM structure of the human spliceosomal B complex protomer (tri-snRNP core region)
8QOZ 3.1 Å, Cryo-EM Structure of Pre-B+5'ss+ATPgammaS Complex (core part)
8H6E 3.2 Å, Cryo-EM structure of human exon-defined spliceosome in the late pre-B state.

Browse structure collections

About this viewer

MolViewer shows 8QPE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.