Solution structure of the a-subunit of human chorionic gonadotropin [including a single glcnac residue at ASN52 and ASN78]. Determined by solution NMR. Released 25 Jul 2002.
Explore 1E9J in 3D Show helices and sheets RCSB PDB PDBe
1E9J contains 1 α-helix and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9 | 1 | 1 |
| β-strand | 20 | 1 | 2 |
| β-strand | 23 | 1 | 2 |
| β-strand | 32 | 1 | 1 |
| β-strand | 64 | 1 | 3 |
| α-helix | 71-73 | 3 | |
| β-strand | 81 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chorionic gonadotropin | A | protein | 92 | HOMO SAPIENS | P01215 (AlphaFold model) |
>1E9J_1 CHORIONIC GONADOTROPIN (chains A) APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
Effects of the N-linked glycans on the 3D structure of the free alpha-subunit of human chorionic gonadotropin. Erbel, P.J., Karimi-Nejad, Y., van Kuik, J.A. et al. Biochemistry (2000) 39:6012-6021. DOI 10.1021/BI992786N · PubMed
Other PDB entries of the same protein (UniProt P01215 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1E9J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.