Apolipoprotein E3 22kD fragment LYS146GLU mutant. Determined by X-ray diffraction at 1.95 Å resolution. Released 13 Jul 2001.
Explore 1EA8 in 3D Show helices and sheets RCSB PDB PDBe
1EA8 contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 25-41 | 17 | |
| α-helix | 45-52 | 8 | |
| α-helix | 55-78 | 24 | |
| α-helix | 82-84 | 3 | |
| α-helix | 87-124 | 38 | |
| α-helix | 131-160 | 30 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Apolipoprotein E | A | protein | 191 | HOMO SAPIENS | P02649 (AlphaFold model) |
>1EA8_1 APOLIPOPROTEIN E (chains A) KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQEL RALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRG EVQAMLGQSTEELRVRLASHLRKLRERLLRDADDLQKRLAVYQAGAREGAERGLSAIRER LGPLVEQGRVR
Apolipoprotein E3 22Kd Fragment Lys146Gln Mutant. Rupp, B., Peters-Libeu, C., Verderame, J. To be published.
Other PDB entries of the same protein (UniProt P02649 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1EA8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.