1EAO: THE RUNX1 Runt domain

THE RUNX1 Runt domain at 1.4A resolution: a structural switch and specifically bound chloride ions modulate DNA binding. Determined by X-ray diffraction at 1.4 Å resolution. Released 12 Sept 2002.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: MUS MUSCULUS
Chains: 2
Atoms: 2,281
Mol. weight: 31.37 kDa
Released: 12 Sept 2002

Explore 1EAO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EAO contains 6 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	51-57	7
β-strand	63-64	2	1
β-strand	70-72	3	1
α-helix	74-76	3
β-strand	78-80	3	2
α-helix	83-85	3
β-strand	90-93	4	1
β-strand	102-109	8	3
β-strand	112-115	4	3
β-strand	117-118	2	4
β-strand	121-123	3	3
β-strand	124-125	2	1
β-strand	128-130	3	1
β-strand	135-136	2	4
β-strand	146	1	5
β-strand	147-152	6	3
β-strand	158-161	4	3
β-strand	166	1	5
β-strand	167-169	3	2

Chain B: 3 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	51-57	7
β-strand	63-64	2	6
β-strand	70-72	3	6
β-strand	78-80	3	7
α-helix	83-85	3
β-strand	90-93	4	6
β-strand	102-108	7	8
β-strand	115	1	8
β-strand	117-118	2	9
β-strand	121-123	3	8
β-strand	124-125	2	6
β-strand	128-130	3	6
β-strand	135-136	2	9
α-helix	144-145	2
β-strand	146	1	10
β-strand	147-152	6	8
β-strand	158-161	4	8
β-strand	166	1	10
β-strand	167-169	3	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Runt-related transcription factor 1	A, B	protein	140	MUS MUSCULUS	Q03347 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1EAO_1 RUNT-RELATED TRANSCRIPTION FACTOR 1 (chains A, B)
SGDRSMVEVLADHPGELVRTDSPNFLSSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTV
MAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRA
IKITVDGPREPRRHRQKLDD

Primary citation

The Runx1 Runt Domain at 1.25A Resolution: A Structural Switch and Specifically Bound Chloride Ions Modulate DNA Binding. Backstrom, S., Wolf-Watz, M., Grundstrom, C. et al. J Mol Biol (2002) 322:259. DOI 10.1016/S0022-2836(02)00702-7 · PubMed

Other PDB entries of the same protein (UniProt Q03347 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1EAQ 1.25 Å, The RUNX1 Runt domain at 1.25A resolution: A structural switch and specifically bound…
1EAN 1.7 Å, THE RUNX1 Runt domain at 1.70A resolution: A structural switch and specifically bound…
4L18 2.3 Å, Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 3)
3WTS 2.35 Å, Crystal structure of the complex comprised of ETS1, RUNX1, CBFBETA, and the tcralpha…
3WTT 2.35 Å, Crystal structure of the complex comprised of phosphorylated ETS1, RUNX1, CBFBETA, and…
3WU1 2.4 Å, Crystal structure of the ETS1-RUNX1-DNA ternary complex
4L0Y 2.5 Å, Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 1)
2J6W 2.6 Å, R164N mutant of the RUNX1 Runt domain
1HJC 2.65 Å, Crystal structure of runx-1/AML1/CBFALPHA runt domain bound to a DNA fragment from the…
3WTU 2.7 Å, Crystal structure of the complex comprised of ETS1 (V170A), RUNX1, CBFBETA, and the…
3WTV 2.7 Å, Crystal structure of the complex comprised of ETS1(V170G), RUNX1, CBFBETA, and the…
3WTY 2.7 Å, Crystal structure of the complex comprised of ETS1(G333P), RUNX1, CBFBETA, and the…

Browse structure collections

About this viewer

MolViewer shows 1EAO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.