The RUNX1 Runt domain at 1.25A resolution: A structural switch and specifically bound chloride ions modulate DNA binding. Determined by X-ray diffraction at 1.25 Å resolution. Released 12 Sept 2002.
Explore 1EAQ in 3D Show helices and sheets RCSB PDB PDBe
1EAQ contains 6 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 51-57 | 7 | |
| β-strand | 63-64 | 2 | 1 |
| β-strand | 70-72 | 3 | 1 |
| α-helix | 74-76 | 3 | |
| β-strand | 78-80 | 3 | 2 |
| α-helix | 83-85 | 3 | |
| β-strand | 90-93 | 4 | 1 |
| β-strand | 102-109 | 8 | 3 |
| β-strand | 112-115 | 4 | 3 |
| β-strand | 117-118 | 2 | 4 |
| β-strand | 121-123 | 3 | 3 |
| β-strand | 124-125 | 2 | 1 |
| β-strand | 128-130 | 3 | 1 |
| β-strand | 135-136 | 2 | 4 |
| β-strand | 146 | 1 | 5 |
| β-strand | 147-152 | 6 | 3 |
| β-strand | 158-161 | 4 | 3 |
| β-strand | 166 | 1 | 5 |
| β-strand | 167-169 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 51-57 | 7 | |
| β-strand | 63-64 | 2 | 6 |
| β-strand | 70-72 | 3 | 6 |
| β-strand | 78-80 | 3 | 7 |
| α-helix | 83-85 | 3 | |
| β-strand | 90-93 | 4 | 6 |
| β-strand | 102-108 | 7 | 8 |
| β-strand | 115 | 1 | 8 |
| β-strand | 117-118 | 2 | 9 |
| β-strand | 121-123 | 3 | 8 |
| β-strand | 124-125 | 2 | 6 |
| β-strand | 128-130 | 3 | 6 |
| β-strand | 135-136 | 2 | 9 |
| α-helix | 144-145 | 2 | |
| β-strand | 146 | 1 | 10 |
| β-strand | 147-152 | 6 | 8 |
| β-strand | 158-161 | 4 | 8 |
| β-strand | 166 | 1 | 10 |
| β-strand | 167-169 | 3 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Runt-related transcription factor 1 | A, B | protein | 140 | MUS MUSCULUS | Q03347 (AlphaFold model) |
>1EAQ_1 RUNT-RELATED TRANSCRIPTION FACTOR 1 (chains A, B) SGDRSMVEVLADHPGELVRTDSPNFLSSVLPTHWRSNKTLPIAFKVVALGDVPDGTLVTV MAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRA IKITVDGPREPRRHRQKLDD
The Runx1 Runt Domain at 1.25 A Resolution: A Structural Switch and Specifically Bound Chloride Ions Modulate DNA Binding. Backstrom, S., Wolf-Watz, M., Grundstrom, C. et al. J Mol Biol (2002) 322:259. DOI 10.1016/S0022-2836(02)00702-7 · PubMed
Other PDB entries of the same protein (UniProt Q03347 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1EAQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.