4L18: Runx1 and Ets1

Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 3). Determined by X-ray diffraction at 2.3 Å resolution. Released 26 Mar 2014.

Method: X-ray diffraction
Resolution: 2.3 Å
Organisms: Mus musculus, Homo sapiens
Chains: 8
Atoms: 5,431
Mol. weight: 91.12 kDa
Released: 26 Mar 2014

Explore 4L18 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4L18 contains 16 α-helices and 38 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	62-64	3	1
β-strand	70-73	4	1
α-helix	74-76	3
β-strand	78-80	3	2
β-strand	90-93	4	1
β-strand	99	1	3
β-strand	102-108	7	4
β-strand	117-118	2	5
β-strand	121-123	3	4
β-strand	124-125	2	1
β-strand	128-130	3	1
β-strand	135-136	2	5
β-strand	146-152	7	4
β-strand	158-166	9	4
β-strand	167-169	3	2
β-strand	191	1	6
α-helix	194-203	10

Chain B: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	337-344	8
α-helix	348-350	3
β-strand	355-356	2	7
β-strand	362-364	3	7
α-helix	368-379	12
α-helix	386-398	13
β-strand	402-404	3	7
β-strand	411-414	4	7
α-helix	418-422	5
α-helix	426-432	7

Chain E: 2 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	62-64	3	8
β-strand	70-73	4	8
α-helix	74-76	3
β-strand	78-80	3	9
β-strand	90-93	4	8
β-strand	99	1	6
β-strand	102-108	7	10
β-strand	117-118	2	11
β-strand	121-123	3	10
β-strand	124-125	2	8
β-strand	128-130	3	8
β-strand	135-136	2	11
β-strand	146-152	7	10
β-strand	158-166	9	10
β-strand	167-169	3	9
β-strand	191	1	3
α-helix	194-201	8

Chain F: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	337-345	9
α-helix	348-350	3
β-strand	355-356	2	12
β-strand	362-364	3	12
α-helix	368-379	12
α-helix	386-398	13
β-strand	402-404	3	12
β-strand	411-414	4	12
α-helix	418-422	5
α-helix	426-432	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Runt-related transcription factor 1	A, E	protein	167	Mus musculus	Q03347 (AlphaFold model)
Protein C-ets-1	B, F	protein	146	Homo sapiens	P14921 (AlphaFold model)
5'-d(gpgpapapgpcpcpapcpaptpcpcptpcpt)-3'	C, G	DNA	16	Homo sapiens
5'-d(cpapgpapgpgpaptpgptpgpgpcptptpc)-3'	D, H	DNA	16	Homo sapiens

Sequence of entity 1 (A, E), FASTA

>4L18_1 Runt-related transcription factor 1 (chains A, E)
DRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMA
GNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIK
ITVDGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPH

Sequence of entity 2 (B, F), FASTA

>4L18_2 Protein C-ets-1 (chains B, F)
PNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFIS
WTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFV
CDLQSLLGYTPEELHAMLDVKPDADE

Sequence of entity 3 (C, G), FASTA

>4L18_3 5'-D(*GP*GP*AP*AP*GP*CP*CP*AP*CP*AP*TP*CP*CP*TP*CP*T)-3' (chains C, G)
GGAAGCCACATCCTCT

Sequence of entity 4 (D, H), FASTA

>4L18_4 5'-D(*CP*AP*GP*AP*GP*GP*AP*TP*GP*TP*GP*GP*CP*TP*TP*C)-3' (chains D, H)
CAGAGGATGTGGCTTC

Primary citation

Structural basis of Ets1 activation by Runx1. Shrivastava, T., Mino, K., Babayeva, N.D. et al. Leukemia (2014) 28:2040-2048. DOI 10.1038/leu.2014.111 · PubMed

Other PDB entries of the same protein (UniProt Q03347 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1EAQ 1.25 Å, The RUNX1 Runt domain at 1.25A resolution: A structural switch and specifically bound…
1EAO 1.4 Å, THE RUNX1 Runt domain at 1.4A resolution: a structural switch and specifically bound…
1EAN 1.7 Å, THE RUNX1 Runt domain at 1.70A resolution: A structural switch and specifically bound…
3WTS 2.35 Å, Crystal structure of the complex comprised of ETS1, RUNX1, CBFBETA, and the tcralpha…
3WTT 2.35 Å, Crystal structure of the complex comprised of phosphorylated ETS1, RUNX1, CBFBETA, and…
3WU1 2.4 Å, Crystal structure of the ETS1-RUNX1-DNA ternary complex
4L0Y 2.5 Å, Crystal structure of Runx1 and Ets1 bound to TCR alpha promoter (crystal form 1)
2J6W 2.6 Å, R164N mutant of the RUNX1 Runt domain
1HJC 2.65 Å, Crystal structure of runx-1/AML1/CBFALPHA runt domain bound to a DNA fragment from the…
3WTU 2.7 Å, Crystal structure of the complex comprised of ETS1 (V170A), RUNX1, CBFBETA, and the…
3WTV 2.7 Å, Crystal structure of the complex comprised of ETS1(V170G), RUNX1, CBFBETA, and the…
3WTY 2.7 Å, Crystal structure of the complex comprised of ETS1(G333P), RUNX1, CBFBETA, and the…

Browse structure collections

About this viewer

MolViewer shows 4L18 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.