1EBP: Epo receptor

Complex between the extracellular domain of erythropoietin (EPO) receptor [ebp] and an agonist peptide [EMP1]. Determined by X-ray diffraction at 2.8 Å resolution. Released 29 Jul 1997.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,546
Mol. weight: 50.85 kDa
Released: 29 Jul 1997

Explore 1EBP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EBP contains 19 α-helices and 45 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	11-18	8
β-strand	27-29	3	1
β-strand	30	1	2
β-strand	37-43	7	1
α-helix	50-52	3
β-strand	53-59	7	3
β-strand	65-67	3	3
β-strand	70-73	4	1
β-strand	78-84	7	1
α-helix	87-89	3
β-strand	96-102	7	3
β-strand	107-113	7	3
α-helix	115-117	3
β-strand	119-120	2	2
α-helix	121-124	4
β-strand	125-132	8	4
β-strand	137-143	7	4
α-helix	144	1
α-helix	151-153	3
β-strand	154-162	9	5
β-strand	170-174	5	5
β-strand	180-183	4	4
β-strand	191-200	10	5
α-helix	201	1
β-strand	207-208	2	2
α-helix	211-215	5
β-strand	216-219	4	5

Chain B: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	11-18	8
β-strand	27-29	3	6
β-strand	30	1	7
β-strand	36-42	7	6
α-helix	50-52	3
β-strand	53-59	7	8
β-strand	65-67	3	8
α-helix	68-69	2
β-strand	71-73	3	6
β-strand	79-85	7	6
α-helix	87-89	3
β-strand	95-102	8	8
β-strand	107-114	8	8
α-helix	115-117	3
β-strand	119	1	7
α-helix	121-124	4
β-strand	125-131	7	9
β-strand	138-143	6	9
α-helix	144	1
α-helix	151-153	3
β-strand	154-162	9	10
β-strand	168	1	10
β-strand	171-174	4	10
β-strand	180-183	4	9
β-strand	192-200	9	10
α-helix	201	1
β-strand	207	1	7
α-helix	211-215	5
β-strand	216-218	3	10

Chain C: 0 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	11
β-strand	7-8	2	12
β-strand	13-14	2	12
β-strand	17	1	11

Chain D: 0 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	11
β-strand	7	1	13
β-strand	14	1	13
β-strand	17	1	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Epo receptor	A, B	protein	211	Homo sapiens	P19235 (AlphaFold model)
Epo mimetics peptide 1	C, D	protein	20

Sequence of entity 1 (A, B), FASTA

>1EBP_1 EPO RECEPTOR (chains A, B)
KFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRL
HQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVA
RLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGR
TRYTFAVRARMAEPSFGGFWSAWSEPVSLLT

Sequence of entity 2 (C, D), FASTA

>1EBP_2 EPO MIMETICS PEPTIDE 1 (chains C, D)
GGTYSCHFGPLTWVCKPQGG

Primary citation

Functional mimicry of a protein hormone by a peptide agonist: the EPO receptor complex at 2.8 A. Livnah, O., Stura, E.A., Johnson, D.L. et al. Science (1996) 273:464-471. PubMed

Other PDB entries of the same protein (UniProt P19235 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1EER 1.9 Å, Crystal structure of human erythropoietin complexed to its receptor at 1.9 Å
6MOI 2.06 Å, Dimeric DARPin C_angle_R5 complex with EpoR
6MOE 2.09 Å, Monomeric DARPin E2 complex with EpoR
8VUI 2.1 Å, Structure of FabS1CE-EPR-1, an elbow-locked Fab, in complex with the erythropoeitin…
1ERN 2.4 Å, Native structure of the extracellular domain of erythropoietin (EPO) receptor [ebp]
6MOJ 2.43 Å, Dimeric DARPin A_angle_R5 complex with EpoR
4Y5V 2.6 Å, Diabody 305 complex with EpoR
6E2Q 2.65 Å, Structure of human JAK2 FERM/SH2 in complex with Erythropoietin Receptor
1EBA 2.7 Å, Complex between the extracellular domain of erythropoietin (EPO) receptor [ebp] and an…
1CN4 2.8 Å, Erythropoietin complexed with extracellular domains of erythropoietin receptor
4Y5Y 2.85 Å, Diabody 330 complex with EpoR
6MOF 2.89 Å, Monomeric DARPin G2 complex with EpoR

Browse structure collections

About this viewer

MolViewer shows 1EBP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.