Crystal structure of yeast karyopherin (importin) alpha in a complex with a C-myc nls peptide. Determined by X-ray diffraction at 2.1 Å resolution. Released 29 Mar 2000.
Explore 1EE4 in 3D Show helices and sheets RCSB PDB PDBe
1EE4 contains 68 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 89-96 | 8 | |
| α-helix | 101-115 | 15 | |
| α-helix | 123-128 | 6 | |
| α-helix | 132-137 | 6 | |
| α-helix | 145-158 | 14 | |
| α-helix | 163-171 | 9 | |
| α-helix | 174-184 | 11 | |
| α-helix | 187-201 | 15 | |
| α-helix | 205-213 | 9 | |
| α-helix | 217-223 | 7 | |
| α-helix | 229-243 | 15 | |
| α-helix | 249-250 | 2 | |
| α-helix | 252-255 | 4 | |
| α-helix | 256-258 | 3 | |
| α-helix | 259-265 | 7 | |
| α-helix | 271-284 | 14 | |
| α-helix | 289-297 | 9 | |
| α-helix | 300-307 | 8 | |
| α-helix | 313-326 | 14 | |
| α-helix | 331-339 | 9 | |
| α-helix | 342-349 | 8 | |
| α-helix | 355-368 | 14 | |
| α-helix | 373-381 | 9 | |
| α-helix | 385-394 | 10 | |
| α-helix | 397-411 | 15 | |
| α-helix | 412-415 | 4 | |
| α-helix | 418-426 | 9 | |
| α-helix | 430-435 | 6 | |
| α-helix | 436-438 | 3 | |
| α-helix | 442-465 | 24 | |
| α-helix | 472-479 | 8 | |
| α-helix | 482-489 | 8 | |
| α-helix | 495-508 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 89-96 | 8 | |
| α-helix | 101-115 | 15 | |
| α-helix | 123-128 | 6 | |
| α-helix | 132-137 | 6 | |
| α-helix | 145-158 | 14 | |
| α-helix | 163-171 | 9 | |
| α-helix | 174-184 | 11 | |
| α-helix | 187-201 | 15 | |
| α-helix | 205-213 | 9 | |
| α-helix | 217-222 | 6 | |
| α-helix | 223-225 | 3 | |
| α-helix | 229-243 | 15 | |
| α-helix | 249-250 | 2 | |
| α-helix | 252-255 | 4 | |
| α-helix | 256-258 | 3 | |
| α-helix | 259-265 | 7 | |
| α-helix | 271-285 | 15 | |
| α-helix | 289-297 | 9 | |
| α-helix | 300-307 | 8 | |
| α-helix | 313-326 | 14 | |
| α-helix | 331-339 | 9 | |
| α-helix | 342-349 | 8 | |
| α-helix | 355-369 | 15 | |
| α-helix | 373-381 | 9 | |
| α-helix | 385-394 | 10 | |
| α-helix | 397-411 | 15 | |
| α-helix | 412-415 | 4 | |
| α-helix | 419-426 | 8 | |
| α-helix | 430-435 | 6 | |
| α-helix | 436-438 | 3 | |
| α-helix | 442-465 | 24 | |
| α-helix | 472-479 | 8 | |
| α-helix | 482-488 | 7 | |
| α-helix | 489-491 | 3 | |
| α-helix | 495-508 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Karyopherin alpha | A, B | protein | 423 | Saccharomyces cerevisiae | Q02821 (AlphaFold model) |
| Myc proto-oncogene protein | C, D, E, F | protein | 9 | Homo sapiens | P01106 (AlphaFold model) |
>1EE4_1 KARYOPHERIN ALPHA (chains A, B) QELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEM LQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTD YRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP PLVKLLEVAEDKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE VTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIE TYF
>1EE4_2 MYC PROTO-ONCOGENE PROTEIN (chains C, D, E, F) PAAKRVKLD
Crystallographic analysis of the specific yet versatile recognition of distinct nuclear localization signals by karyopherin alpha. Conti, E., Kuriyan, J. Structure (2000) 8:329-338. DOI 10.1016/S0969-2126(00)00107-6 · PubMed
Other PDB entries of the same protein (UniProt Q02821 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1EE4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.