1EE4: Karyopherin alpha

Crystal structure of yeast karyopherin (importin) alpha in a complex with a C-myc nls peptide. Determined by X-ray diffraction at 2.1 Å resolution. Released 29 Mar 2000.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Saccharomyces cerevisiae, Homo sapiens
Chains: 6
Atoms: 6,817
Mol. weight: 97.74 kDa
Released: 29 Mar 2000

Explore 1EE4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EE4 contains 68 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 33 helices, 0 β-strands

Element	Residues	Length
α-helix	89-96	8
α-helix	101-115	15
α-helix	123-128	6
α-helix	132-137	6
α-helix	145-158	14
α-helix	163-171	9
α-helix	174-184	11
α-helix	187-201	15
α-helix	205-213	9
α-helix	217-223	7
α-helix	229-243	15
α-helix	249-250	2
α-helix	252-255	4
α-helix	256-258	3
α-helix	259-265	7
α-helix	271-284	14
α-helix	289-297	9
α-helix	300-307	8
α-helix	313-326	14
α-helix	331-339	9
α-helix	342-349	8
α-helix	355-368	14
α-helix	373-381	9
α-helix	385-394	10
α-helix	397-411	15
α-helix	412-415	4
α-helix	418-426	9
α-helix	430-435	6
α-helix	436-438	3
α-helix	442-465	24
α-helix	472-479	8
α-helix	482-489	8
α-helix	495-508	14

Chain B: 35 helices, 0 β-strands

Element	Residues	Length
α-helix	89-96	8
α-helix	101-115	15
α-helix	123-128	6
α-helix	132-137	6
α-helix	145-158	14
α-helix	163-171	9
α-helix	174-184	11
α-helix	187-201	15
α-helix	205-213	9
α-helix	217-222	6
α-helix	223-225	3
α-helix	229-243	15
α-helix	249-250	2
α-helix	252-255	4
α-helix	256-258	3
α-helix	259-265	7
α-helix	271-285	15
α-helix	289-297	9
α-helix	300-307	8
α-helix	313-326	14
α-helix	331-339	9
α-helix	342-349	8
α-helix	355-369	15
α-helix	373-381	9
α-helix	385-394	10
α-helix	397-411	15
α-helix	412-415	4
α-helix	419-426	8
α-helix	430-435	6
α-helix	436-438	3
α-helix	442-465	24
α-helix	472-479	8
α-helix	482-488	7
α-helix	489-491	3
α-helix	495-508	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Karyopherin alpha	A, B	protein	423	Saccharomyces cerevisiae	Q02821 (AlphaFold model)
Myc proto-oncogene protein	C, D, E, F	protein	9	Homo sapiens	P01106 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1EE4_1 KARYOPHERIN ALPHA (chains A, B)
QELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEM
LQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTD
YRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI
YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI
VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP
PLVKLLEVAEDKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE
VTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIE
TYF

Sequence of entity 2 (C, D, E, F), FASTA

>1EE4_2 MYC PROTO-ONCOGENE PROTEIN (chains C, D, E, F)
PAAKRVKLD

Primary citation

Crystallographic analysis of the specific yet versatile recognition of distinct nuclear localization signals by karyopherin alpha. Conti, E., Kuriyan, J. Structure (2000) 8:329-338. DOI 10.1016/S0969-2126(00)00107-6 · PubMed

Other PDB entries of the same protein (UniProt Q02821 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WA5 2.0 Å, Structure of the Cse1:Imp-alpha:RanGTP complex
1BK5 2.2 Å, Karyopherin alpha from saccharomyces cerevisiae
5H2X 2.2 Å, Crystal structure of the karyopherin Kap60p bound to the SUMO protease Ulp1p (150-172)
4XZR 2.25 Å, Structure of yeast importin a bound to the membrane protein Nuclear Localization Signal…
1EE5 2.4 Å, Yeast karyopherin (importin) alpha in a complex with a nucleoplasmin nls peptide
4PVZ 2.5 Å, Structure of yeast importin a bound to the membrane protein Nuclear Localization Signal…
5H2W 2.5 Å, Crystal structure of the karyopherin Kap60p bound to the SUMO protease Ulp1p (150-340)
1UN0 2.6 Å, Crystal Structure of Yeast Karyopherin (Importin) alpha in complex with a Nup2p…
2C1T 2.6 Å, Structure of the Kap60p:Nup2 complex
5T94 2.63 Å, Crystal structure of Kap60 bound to yeast RCC1 (Prp20)
1BK6 2.8 Å, Karyopherin alpha (YEAST) + SV40 T antigen nls

Browse structure collections

About this viewer

MolViewer shows 1EE4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.