1EE5: Karyopherin alpha

Yeast karyopherin (importin) alpha in a complex with a nucleoplasmin nls peptide. Determined by X-ray diffraction at 2.4 Å resolution. Released 29 Mar 2000.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Saccharomyces cerevisiae, Xenopus laevis
Chains: 2
Atoms: 3,258
Mol. weight: 48.96 kDa
Released: 29 Mar 2000

Explore 1EE5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EE5 contains 36 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 36 helices, 0 β-strands

Element	Residues	Length
α-helix	91-96	6
α-helix	101-115	15
α-helix	123-128	6
α-helix	132-136	5
α-helix	137-139	3
α-helix	145-159	15
α-helix	163-171	9
α-helix	175-184	10
α-helix	187-201	15
α-helix	205-213	9
α-helix	217-222	6
α-helix	223-225	3
α-helix	229-243	15
α-helix	249-251	3
α-helix	252-255	4
α-helix	256-258	3
α-helix	259-265	7
α-helix	271-284	14
α-helix	289-297	9
α-helix	301-306	6
α-helix	307-309	3
α-helix	313-326	14
α-helix	331-339	9
α-helix	342-349	8
α-helix	355-366	12
α-helix	373-381	9
α-helix	385-393	9
α-helix	397-411	15
α-helix	412-415	4
α-helix	419-426	8
α-helix	430-434	5
α-helix	442-465	24
α-helix	472-479	8
α-helix	482-488	7
α-helix	489-491	3
α-helix	495-508	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Karyopherin alpha	A	protein	424	Saccharomyces cerevisiae	Q02821 (AlphaFold model)
Nucleoplasmin	B	protein	19	Xenopus laevis	P05221 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1EE5_1 KARYOPHERIN ALPHA (chains A)
QELPQMTQQLNSDDMQEQLSATVKFRQILSREHRPPIDVVIQAGVVPRLVEFMRENQPEM
LQLEAAWALTNIASGTSAQTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTD
YRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLI
YSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNI
VTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIP
PLVKLLEVAEDKTKKEACWAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIE
VTLDALENILKMGEADKEARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIE
TYFG

Sequence of entity 2 (B), FASTA

>1EE5_2 NUCLEOPLASMIN (chains B)
AVKRPAATKKAGQAKKKKL

Primary citation

Crystallographic analysis of the specific yet versatile recognition of distinct nuclear localization signals by karyopherin alpha. Conti, E., Kuriyan, J. Structure (2000) 8:329-338. DOI 10.1016/S0969-2126(00)00107-6 · PubMed

Other PDB entries of the same protein (UniProt Q02821 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1WA5 2.0 Å, Structure of the Cse1:Imp-alpha:RanGTP complex
1EE4 2.1 Å, Crystal structure of yeast karyopherin (importin) alpha in a complex with a C-myc nls…
1BK5 2.2 Å, Karyopherin alpha from saccharomyces cerevisiae
5H2X 2.2 Å, Crystal structure of the karyopherin Kap60p bound to the SUMO protease Ulp1p (150-172)
4XZR 2.25 Å, Structure of yeast importin a bound to the membrane protein Nuclear Localization Signal…
4PVZ 2.5 Å, Structure of yeast importin a bound to the membrane protein Nuclear Localization Signal…
5H2W 2.5 Å, Crystal structure of the karyopherin Kap60p bound to the SUMO protease Ulp1p (150-340)
1UN0 2.6 Å, Crystal Structure of Yeast Karyopherin (Importin) alpha in complex with a Nup2p…
2C1T 2.6 Å, Structure of the Kap60p:Nup2 complex
5T94 2.63 Å, Crystal structure of Kap60 bound to yeast RCC1 (Prp20)
1BK6 2.8 Å, Karyopherin alpha (YEAST) + SV40 T antigen nls

Browse structure collections

About this viewer

MolViewer shows 1EE5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.