The crystal structure of elongation factor ef-tu from thermus aquaticus in the GTP conformation. Determined by X-ray diffraction at 2.5 Å resolution. Released 31 Aug 1994.
Explore 1EFT in 3D Show helices and sheets RCSB PDB PDBe
1EFT contains 15 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3 | 1 | |
| β-strand | 4 | 1 | 1 |
| α-helix | 5 | 1 | |
| β-strand | 11-17 | 7 | 2 |
| α-helix | 24-36 | 13 | |
| α-helix | 47-49 | 3 | |
| α-helix | 54-59 | 6 | |
| β-strand | 66-71 | 6 | 2 |
| β-strand | 76-81 | 6 | 2 |
| α-helix | 86-88 | 3 | |
| α-helix | 89-96 | 8 | |
| β-strand | 102-107 | 6 | 2 |
| α-helix | 114-124 | 11 | |
| β-strand | 131-136 | 6 | 2 |
| α-helix | 138-140 | 3 | |
| α-helix | 146-159 | 14 | |
| β-strand | 170-172 | 3 | 2 |
| α-helix | 175-184 | 10 | |
| α-helix | 194-209 | 16 | |
| α-helix | 211-213 | 3 | |
| β-strand | 222-224 | 3 | 3 |
| β-strand | 225-231 | 7 | 1 |
| β-strand | 235-241 | 7 | 1 |
| β-strand | 244 | 1 | 3 |
| β-strand | 246-248 | 3 | 4 |
| β-strand | 252-255 | 4 | 3 |
| β-strand | 263-266 | 4 | 3 |
| β-strand | 267-272 | 6 | 1 |
| β-strand | 275-277 | 3 | 1 |
| β-strand | 279-281 | 3 | 4 |
| β-strand | 285-290 | 6 | 1 |
| β-strand | 300 | 1 | 5 |
| β-strand | 302 | 1 | 5 |
| β-strand | 303-305 | 3 | 3 |
| β-strand | 313-322 | 10 | 6 |
| α-helix | 323-324 | 2 | |
| α-helix | 325-327 | 3 | |
| β-strand | 334 | 1 | 7 |
| β-strand | 341-344 | 4 | 6 |
| β-strand | 347-354 | 8 | 6 |
| β-strand | 362 | 1 | 7 |
| β-strand | 367-378 | 12 | 6 |
| β-strand | 385-390 | 6 | 6 |
| β-strand | 393-403 | 11 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Elongation factor tu | A | protein | 405 | Thermus aquaticus | Q01698 (AlphaFold model) |
>1EFT_1 ELONGATION FACTOR TU (chains A) AKGEFIRTKPHVNVGTIGHVDHGKTTLTAALTFVTAAENPNVEVKDYGDIDKAPEERARG ITINTAHVEYETAKRHYSHVDCPGHADYIKNMITGAAQMDGAILVVSAADGPMPQTREHI LLARQVGVPYIVVFMNKVDMVDDPELLDLVEMEVRDLLNQYEFPGDEVPVIRGSALLALE EMHKNPKTKRGENEWVDKIWELLDAIDEYIPTPVRDVDKPFLMPVEDVFTITGRGTVATG RIERGKVKVGDEVEIVGLAPETRKTVVTGVEMHRKTLQEGIAGDNVGLLLRGVSREEVER GQVLAKPGSITPHTKFEASVYVLKKEEGGRHTGFFSGYRPQFYFRTTDVTGVVRLPQGVE MVMPGDNVTFTVELIKPVALEEGLRFAIREGGRTVGAGVVTKILE
| ID | Name | Formula | Copies |
|---|---|---|---|
| GNP | Phosphoaminophosphonic acid-guanylate ester | C10 H17 N6 O13 P3 | 1 |
| MG | Magnesium ion | Mg | 1 |
The crystal structure of elongation factor EF-Tu from Thermus aquaticus in the GTP conformation. Kjeldgaard, M., Nissen, P., Thirup, S. et al. Structure (1993) 1:35-50. DOI 10.1016/0969-2126(93)90007-4 · PubMed
Other PDB entries of the same protein (UniProt Q01698 (AlphaFold model), which also has an AlphaFold model), best resolution first:
1EFT is part of these collections:
MolViewer shows 1EFT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.