1EH2: EPS15

Structure of the second EPS15 homology domain of human EPS15, NMR, 20 structures. Determined by solution NMR. Released 22 Jul 1999.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 743
Mol. weight: 11.98 kDa
Ligands: CA
Released: 22 Jul 1999

Explore 1EH2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EH2 contains 4 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	11-21	11
β-strand	32	1	1
α-helix	33-41	9
α-helix	47-57	11
β-strand	64	1	1
α-helix	67-82	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
EPS15	A	protein	106	Homo sapiens	P42566 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1EH2_1 EPS15 (chains A)
NRWGSPWAVKPEDKAKYDAIFDSLSPVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDID
HDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALVPPSKRKTWLEI

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Primary citation

Structure and Asn-Pro-Phe binding pocket of the Eps15 homology domain. de Beer, T., Carter, R.E., Lobel-Rice, K.E. et al. Science (1998) 281:1357-1360. DOI 10.1126/science.281.5381.1357 · PubMed

Other PDB entries of the same protein (UniProt P42566 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4RHG 1.58 Å, Crystal structure of PTPN3 (PTPH1) D811E, C842S mutant in complex with Eps15 pTyr849…
4RH9 1.6 Å, Crystal structure of PTPN3 (PTPH1) H812F, M883G mutant in complex with Eps15 pTyr849…
4RH5 1.6 Å, Crystal structure of PTPN3 (PTPH1) in complex with Eps15 pTyr849 peptide
4S0G 1.72 Å, Crystal structure of PTPN3 (PTPH1) in complex with Eps15 pTyr849 P850V peptide
2IV9 1.9 Å, B2-appendage from AP2 in complex with Eps15 peptide
5JP2 2.4 Å, Fcho1 Mu homology domain (Danio Rerio) with bound Eps15 peptide
5AWU 2.7 Å, Crystal structure of the SGIP1 mu homology domain in complex with an Eps15 fragment…
5AWT 2.7 Å, Crystal structure of the SGIP1 mu homology domain in complex with an Eps15 fragment…
1C07 Structure of the third EPS15 homology domain of human EPS15
1F8H Structure of the second EPS15 homology domain of human EPS15 in complex with ptgssstnpfr
1FF1 Structure of the second EPS15 homology domain of human EPS15 in complex with ptgssstnpfl
2JXC Structure of the EPS15-EH2 Stonin2 Complex

Browse structure collections

About this viewer

MolViewer shows 1EH2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.