Crystal structure of the SGIP1 mu homology domain in complex with an Eps15 fragment containing two DPF motifs (YDPFKGSDPFA). Determined by X-ray diffraction at 2.7 Å resolution. Released 6 Jul 2016.
Explore 5AWU in 3D Show helices and sheets RCSB PDB PDBe
5AWU contains 10 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 560-575 | 16 | 1 |
| α-helix | 579-581 | 3 | |
| β-strand | 583-595 | 13 | 1 |
| α-helix | 598-601 | 4 | |
| α-helix | 608-610 | 3 | |
| β-strand | 612-616 | 5 | 2 |
| α-helix | 618-620 | 3 | |
| β-strand | 621-626 | 6 | 1 |
| β-strand | 642-646 | 5 | 2 |
| α-helix | 649-662 | 14 | |
| β-strand | 668-678 | 11 | 1 |
| α-helix | 682-685 | 4 | |
| β-strand | 688-697 | 10 | 3 |
| β-strand | 700-709 | 10 | 3 |
| α-helix | 711-713 | 3 | |
| β-strand | 720-728 | 9 | 1 |
| β-strand | 733-740 | 8 | 3 |
| β-strand | 744-746 | 3 | 1 |
| β-strand | 751-759 | 9 | 1 |
| α-helix | 764-766 | 3 | |
| β-strand | 768-777 | 10 | 3 |
| α-helix | 781-784 | 4 | |
| α-helix | 786 | 1 | |
| β-strand | 787-794 | 8 | 1 |
| β-strand | 802-806 | 5 | 2 |
| β-strand | 810-827 | 18 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SH3-containing GRB2-like protein 3-interacting protein 1 | A | protein | 282 | Homo sapiens | Q9BQI5 (AlphaFold model) |
| Epidermal growth factor receptor substrate 15 | B | protein | 11 | Homo sapiens | P42566 (AlphaFold model) |
>5AWU_1 SH3-containing GRB2-like protein 3-interacting protein 1 (chains A) GPLGSLTMGAQDTLPVAAAFTETVNAYFKGADPSKCIVKITGEMVLSFPAGITRHFANNP SPAALTFRVINFSRLEHVLPNPQLLCCDNTQNDANTKEFWVNMPNLMTHLKKVSEQKPQA TYYNVDMLKYQVSAQGIQSTPLNLAVNWRCEPSSTDLRIDYKYNTDAMTTAVALNNVQFL VPIDGGVTKLQAVLPPAVWNAEQQRILWKIPDISQKSENGGVGSLLARFQLSEGPSKPSP LVVQFTSEGSTLSGCDIELVGAGYRFSLIKKRFAAGKYLADN
>5AWU_2 Epidermal growth factor receptor substrate 15 (chains B) YDPFKGSDPFA
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
Structural basis for the recognition of two consecutive mutually interacting DPF motifs by the SGIP1 mu homology domain. Shimada, A., Yamaguchi, A., Kohda, D. Sci Rep (2016) 6:19565-19565. DOI 10.1038/srep19565 · PubMed
Other PDB entries of the same protein (UniProt Q9BQI5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5AWU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.