Methylated human O6-alkylguanine-DNA alkyltransferase. Determined by X-ray diffraction at 2.0 Å resolution. Released 12 Apr 2000.
Explore 1EH7 in 3D Show helices and sheets RCSB PDB PDBe
1EH7 contains 9 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-12 | 5 | 1 |
| β-strand | 19-24 | 6 | 1 |
| β-strand | 27-33 | 7 | 1 |
| β-strand | 50 | 1 | 1 |
| α-helix | 57-71 | 15 | |
| α-helix | 73-78 | 6 | |
| α-helix | 80-83 | 4 | |
| β-strand | 84 | 1 | 1 |
| α-helix | 87-90 | 4 | |
| α-helix | 94-105 | 12 | |
| β-strand | 112-113 | 2 | 2 |
| α-helix | 114-120 | 7 | |
| α-helix | 127-134 | 8 | |
| β-strand | 140 | 1 | 3 |
| β-strand | 143 | 1 | 3 |
| α-helix | 145-147 | 3 | |
| β-strand | 148-149 | 2 | 2 |
| α-helix | 162-171 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| O6-alkylguanine-DNA alkyltransferase | A | protein | 207 | Homo sapiens | P16455 (AlphaFold model) |
>1EH7_1 O6-ALKYLGUANINE-DNA ALKYLTRANSFERASE (chains A) MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLM QCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAAL AGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPG LGGSSGLAGAWLKGAGATSGSPPAGRN
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Active and alkylated human AGT structures: a novel zinc site, inhibitor and extrahelical base binding. Daniels, D.S., Mol, C.D., Arvai, A.S. et al. EMBO J (2000) 19:1719-1730. DOI 10.1093/emboj/19.7.1719 · PubMed
Other PDB entries of the same protein (UniProt P16455 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1EH7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.