1EJ5: Autoinhibited conformation of wasp

Solution structure of the autoinhibited conformation of wasp. Determined by solution NMR. Released 5 Apr 2000.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 814
Mol. weight: 11.6 kDa
Released: 5 Apr 2000

Explore 1EJ5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EJ5 contains 6 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	12	1	1
β-strand	16	1	1
α-helix	24-32	9
α-helix	37-40	4
α-helix	43-55	13
α-helix	58-68	11
α-helix	81-88	8
α-helix	89-92	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Wiskott-aldrich syndrome protein	A	protein	107	Homo sapiens	P42768 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1EJ5_1 WISKOTT-ALDRICH SYNDROME PROTEIN (chains A)
SGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGLE
AVRQEMRRQGGSGGSQSSEGLVGALMHVMQKRSRAIHSSDEGEDQAG

Primary citation

Autoinhibition and activation mechanisms of the Wiskott-Aldrich syndrome protein. Kim, A.S., Kakalis, L.T., Abdul-Manan, N. et al. Nature (2000) 404:151-158. DOI 10.1038/35010088 · PubMed

Other PDB entries of the same protein (UniProt P42768 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OT0 2.05 Å, Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with a C-terminal…
2A3Z 2.08 Å, Ternary complex of the WH2 domain of WASP with Actin-DNAse I
1CEE Solution structure of CDC42 in complex with the gtpase binding domain of wasp
1T84 Solution structure of the Wiskott-Aldrich Syndrome Protein (WASP) autoinhibited core…
2K42 Solution Structure of the GTPase Binding Domain of WASP in Complex with EspFU, an EHEC…
9S9X Human WASP/WIP complex

Browse structure collections

About this viewer

MolViewer shows 1EJ5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.