1EKU: Interferon gamma

Crystal structure of a biologically active single chain mutant of human ifn-gamma. Determined by X-ray diffraction at 2.9 Å resolution. Released 1 Sept 2000.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,232
Mol. weight: 63.02 kDa
Released: 1 Sept 2000

Explore 1EKU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1EKU contains 25 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	4-14	11
α-helix	30-34	5
α-helix	39-58	20
α-helix	64-82	19
α-helix	86-96	11
α-helix	103-118	16
α-helix	125-134	10
α-helix	150-154	5
α-helix	159-178	20
α-helix	184-202	19
α-helix	206-216	11
α-helix	223-231	9
α-helix	233-238	6

Chain B: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	3-14	12
α-helix	30-34	5
α-helix	39-60	22
α-helix	64-82	19
α-helix	86-96	11
α-helix	103-119	17
α-helix	125-134	10
α-helix	150-154	5
α-helix	159-180	22
α-helix	184-202	19
α-helix	206-217	12
α-helix	223-238	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon gamma	A, B	protein	265	Homo sapiens	P01579 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1EKU_1 Interferon gamma (chains A, B)
MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKN
FKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIDELIQVMAE
FSTEEQQEGPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFY
FKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHEL
IQVMAELSPAAKTGKRKRSQMLFRG

Primary citation

Design, characterization, and structure of a biologically active single-chain mutant of human IFN-gamma. Landar, A., Curry, B., Parker, M.H. et al. J Mol Biol (2000) 299:169-179. DOI 10.1006/jmbi.2000.3734 · PubMed

Other PDB entries of the same protein (UniProt P01579 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FYH 2.04 Å, 1:1 complex between an interferon gamma single-chain variant and its receptor
3BES 2.2 Å, Structure of a Poxvirus ifngbp/ifng Complex
1FG9 2.9 Å, 3:1 complex of interferon-gamma receptor with interferon-gamma dimer
9VNP 3.02 Å, The complexes of IFN-gamma and A01BM-03 Fab
6E3K 3.25 Å, Interferon gamma signalling complex with IFNGR1 and IFNGR2
1HIG 3.5 Å, Three-dimensional structure of recombinant human interferon-gamma.
6E3L 3.8 Å, Interferon gamma signalling complex with IFNGR1 and IFNGR2

Browse structure collections

About this viewer

MolViewer shows 1EKU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.