9VNP: The complexes of IFN-gamma and A01BM-03 Fab

The complexes of IFN-gamma and A01BM-03 Fab. Determined by X-ray diffraction at 3.02 Å resolution. Released 28 Jan 2026.

Method: X-ray diffraction
Resolution: 3.02 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,117
Mol. weight: 69.57 kDa
Released: 28 Jan 2026

Explore 9VNP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9VNP contains 22 α-helices and 47 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	1
β-strand	9-12	4	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	35-39	5	2
β-strand	46-49	4	2
β-strand	50	1	3
β-strand	54	1	3
α-helix	55-56	2
β-strand	63-68	6	1
β-strand	73-78	6	1
α-helix	83-85	3
β-strand	88-95	8	2
β-strand	100-103	4	2
β-strand	107-111	5	2
α-helix	114-116	3
β-strand	117	1	4
α-helix	118-119	2
β-strand	120-124	5	5
α-helix	125-127	3
α-helix	128-132	5
β-strand	136-145	10	5
β-strand	146	1	4
β-strand	151-156	6	6
β-strand	159-161	3	6
β-strand	165-167	3	5
α-helix	168-170	3
β-strand	171-172	2	5
β-strand	178-186	9	5
α-helix	188-192	5
β-strand	197-203	7	6
β-strand	206-212	7	6

Chain C: 7 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	10-12	3	8
β-strand	18-25	8	7
α-helix	29-31	3
β-strand	34-39	6	8
β-strand	45-51	7	8
β-strand	58-60	3	8
β-strand	68-73	6	7
β-strand	78-83	6	7
α-helix	88-90	3
β-strand	92-98	7	8
β-strand	109-110	2	8
β-strand	114-118	5	8
β-strand	124	1	9
α-helix	125-126	2
β-strand	127-131	5	10
β-strand	142-152	11	10
β-strand	153	1	9
β-strand	158-161	4	11
α-helix	162-164	3
β-strand	166	1	11
β-strand	170-172	3	10
α-helix	173-175	3
β-strand	176-177	2	10
β-strand	183-192	10	10
β-strand	196	1	12
β-strand	199	1	12
β-strand	201-207	7	11
α-helix	208-210	3
β-strand	212-218	7	11
α-helix	220-222	3

Chain L: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	30-34	5
α-helix	39-59	21
α-helix	64-81	18
α-helix	86-97	12
α-helix	105-111	7
α-helix	113-118	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon gamma	L	protein	192	Homo sapiens	P01579 (AlphaFold model)
Light chain	A	protein	218	Homo sapiens
Heavy chain	C	protein	223	Homo sapiens

Sequence of entity 1 (L), FASTA

>9VNP_1 Interferon gamma (chains L)
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNF
KDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAEL
SPAAKTGKRKRSQMLFQGRRASQHHHHHHHHSAWSHPQFEKGGGSGGGGSGGSAWSHPQF
EKGSDYKDDDDK

Sequence of entity 2 (A), FASTA

>9VNP_2 Light chain (chains A)
NFMLTQPHSVSESPGRTVTITCAGSGGYIASYYVQWYQQRPGSAPTTIIFEDSQRPSGVP
DRFSGSIDTSSNSASLIISGLKTEDEADYYCQSFDTDTDHIVFGGGTKLTVLGQPKAAPS
VTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAA
SSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Sequence of entity 3 (C), FASTA

>9VNP_3 Heavy chain (chains C)
QVQLVESGGGVVQPGKSLRLSCEVSGFSLSRYTMFWVRQAPGKGLEWVSLISPDEKKKFY
GDSVTGRCTISRDTSQNILYLQMHNLRPEDTATYYCGRDSSVYITGLQHWGQGTLVTVSS
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC

Primary citation

Identification and characterization of bone marrow plasma cells producing IFN-gamma-neutralizing autoantibodies in adult-onset immunodeficiency. Wang, H., Yang, Q., Zhao, T. et al. Cell Rep Med (2026) 7:102657-102657. DOI 10.1016/j.xcrm.2026.102657 · PubMed

Other PDB entries of the same protein (UniProt P01579 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FYH 2.04 Å, 1:1 complex between an interferon gamma single-chain variant and its receptor
3BES 2.2 Å, Structure of a Poxvirus ifngbp/ifng Complex
1EKU 2.9 Å, Crystal structure of a biologically active single chain mutant of human ifn-gamma
1FG9 2.9 Å, 3:1 complex of interferon-gamma receptor with interferon-gamma dimer
6E3K 3.25 Å, Interferon gamma signalling complex with IFNGR1 and IFNGR2
1HIG 3.5 Å, Three-dimensional structure of recombinant human interferon-gamma.
6E3L 3.8 Å, Interferon gamma signalling complex with IFNGR1 and IFNGR2

Browse structure collections

About this viewer

MolViewer shows 9VNP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.