1FYH: Interferon gamma

1:1 complex between an interferon gamma single-chain variant and its receptor. Determined by X-ray diffraction at 2.04 Å resolution. Released 11 Oct 2000.

Method: X-ray diffraction
Resolution: 2.04 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,687
Mol. weight: 112.13 kDa
Released: 11 Oct 2000

Explore 1FYH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FYH contains 46 α-helices and 40 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	20-23	4
α-helix	30-35	6
α-helix	39-58	20
α-helix	64-66	3
α-helix	67-82	16
α-helix	86-96	11
α-helix	103-119	17
α-helix	202-215	14
α-helix	230-235	6
α-helix	239-258	20
α-helix	267-281	15
α-helix	286-296	11
α-helix	303-317	15
α-helix	322-323	2

Chain B: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	16-21	6	1
β-strand	23	1	2
β-strand	28-32	5	1
β-strand	41-48	8	3
β-strand	57-63	7	3
β-strand	67-69	3	1
α-helix	71-73	3
β-strand	81-89	9	3
β-strand	92-93	2	3
α-helix	95-96	2
β-strand	97-98	2	3
α-helix	99-101	3
β-strand	102	1	3
α-helix	104-107	4
β-strand	109	1	2
β-strand	114-119	6	4
β-strand	123-129	7	4
α-helix	130-131	2
α-helix	132-134	3
β-strand	152-161	10	5
β-strand	164-171	8	5
β-strand	178	1	4
β-strand	182-188	7	4
β-strand	195-204	10	5
β-strand	210	1	5
α-helix	212-216	5
β-strand	217-220	4	5

Chain D: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	4-14	11
α-helix	20-23	4
α-helix	30-35	6
α-helix	39-58	20
α-helix	64-66	3
α-helix	67-82	16
α-helix	86-97	12
α-helix	103-119	17
α-helix	202-215	14
α-helix	230-235	6
α-helix	239-259	21
α-helix	267-281	15
α-helix	286-296	11
α-helix	303-317	15
α-helix	322-323	2

Chain E: 9 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	13-15	3
β-strand	16-21	6	6
β-strand	23	1	7
β-strand	28-32	5	6
α-helix	39-40	2
β-strand	41-48	8	8
β-strand	57-63	7	8
β-strand	67-69	3	6
α-helix	71-73	3
β-strand	81-89	9	8
β-strand	92-93	2	8
α-helix	95-96	2
β-strand	97-98	2	8
α-helix	99-101	3
β-strand	102	1	8
α-helix	104-107	4
β-strand	109	1	7
β-strand	114-119	6	9
β-strand	123-129	7	9
α-helix	130-131	2
α-helix	132-134	3
β-strand	152-161	10	10
β-strand	164-171	8	10
β-strand	178	1	9
β-strand	182-188	7	9
β-strand	195-204	10	10
β-strand	210	1	10
α-helix	212-216	5
β-strand	217-220	4	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon gamma	A, D	protein	258	Homo sapiens	P01579 (AlphaFold model)
Interferon gamma receptor 1	B, E	protein	229	Homo sapiens	P15260 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>1FYH_1 Interferon gamma (chains A, D)
MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKN
FKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIDELIQVMAE
LGANVSGEFVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFK
LFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQ
VMAELSPAAKTGKRKRSQ

Sequence of entity 2 (B, E), FASTA

>1FYH_2 Interferon gamma receptor 1 (chains B, E)
EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDAC
INISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKE
EKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDE
IQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGS

Primary citation

The structure and activity of a monomeric interferon-gamma:alpha-chain receptor signaling complex. Randal, M., Kossiakoff, A.A. Structure (2001) 9:155-163. DOI 10.1016/S0969-2126(01)00567-6 · PubMed

Other PDB entries of the same protein (UniProt P01579 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3BES 2.2 Å, Structure of a Poxvirus ifngbp/ifng Complex
1EKU 2.9 Å, Crystal structure of a biologically active single chain mutant of human ifn-gamma
1FG9 2.9 Å, 3:1 complex of interferon-gamma receptor with interferon-gamma dimer
9VNP 3.02 Å, The complexes of IFN-gamma and A01BM-03 Fab
6E3K 3.25 Å, Interferon gamma signalling complex with IFNGR1 and IFNGR2
1HIG 3.5 Å, Three-dimensional structure of recombinant human interferon-gamma.
6E3L 3.8 Å, Interferon gamma signalling complex with IFNGR1 and IFNGR2

Browse structure collections

About this viewer

MolViewer shows 1FYH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.